Q8RX56 · UNC13_ARATH
- ProteinProtein unc-13 homolog
- GenePATROL1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids1101 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
Controls the tethering of the proton ATPase AHA1 to the plasma membrane. Is essential for stomatal opening in response to low concentration of carbon dioxide and light.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | plasma membrane | |
Cellular Component | plasmodesma | |
Biological Process | protein localization to plasma membrane | |
Biological Process | stomatal movement |
Names & Taxonomy
Protein names
- Recommended nameProtein unc-13 homolog
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ8RX56
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Peripheral membrane protein
Note: Translocates reversibly between the cytoplasm and the plasma membrane depending on environmental conditions.
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Retarded growth due to impaired stomatal movement.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 65 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000443727 | 1-1101 | Protein unc-13 homolog | |||
Sequence: MEEENAVEILQRYRRDRRKLLDFMLAGSLIKKVIMPPGAVTLDDVDLDQVSVDYVINCAKKGGMLELAEAIRDYHDHIGLPYMNSVGTADEFFLATIPESSGSPPKRAPPPIPVLISSSSPMVTNPEWCESPSAPPLMRSESFDSPKAQELTVDDIDDFEDDDDLDEVGNFRISRRTANDAADLVPRLPSFATGITDDDLRETAFEILLACAGASGGLIVPSKEKKKEKSRSRLIKKLGRKSESVSQSQSSSGLVSLLEMMRGQMEISEAMDIRTRQGLLNALAGKVGKRMDSLLVPLELLCCVSRTEFSDKKAYLRWQKRQLNMLAEGLINNPVVGFGESGRKATDLKSLLLRIEESESLPSSAGEVQRAECLKSLREVAISLAERPARGDLTGEVCHWADGYHLNVRLYEKLLLCVFDILNDGKLTEEVEEILELLKSTWRVLGITETIHYTCYAWVLFRQYVITSERGLLRHAIQQLKKIPLKEQRGPQERLHLKTLKCRVDNEEISFLESFLSPIRSWADKQLGDYHLHFAEGSLVMEDTVTVAMITWRLLLEESDRAMHSNSSDREQIESYVLSSIKNTFTRMSLAIDRSDRNNEHHLALLAEETKKLMKKDSTIFMPILSQRHPQAIAFSASLIHKLYGNKLKPFLDGAEHLTEDAVSVFPAADSLEQYLLELMTSVCGEDTSGPYFKKLIPYEVESLSGTLVLRWINSQLGRILSWVERAYKQEHWDPISPQQRYGSSIVEVFRIVEETVDQFFALKVPMRSIELSALFRGIDNAFQVYTNHVMEKLASKDDLVPPVPVLTRYKKETAIKVFVKKELFDSKHLDERRSINIDVPATAMLCVQLNTLHYAVSQLSKLEDSMWLRWIAKKPREKIVIRKSMVEKSKSFNQKESFEGSRKDINAALDRICEFTGTKIIFCDLREPFIENLYKPNVSQSRLEGLIEALDTELGQLCSVIMEPLRDRIVTSLLQASLDGLLRVLLDGGASRVFHPSESKLLEEDVEVLKEFFISGGDGLPRGVVENQVARVRLVVKLHGYETRELIDDLRSRSSLEMQQGGKGKLGADTQTLVRVLCHRNDSEASQFLKKQYKIPRSHG |
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in roots, cotyledons, leaves, stems and flowers. Expressed in guard cells and mesophyll cells of leaves.
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 663-804 | MHD1 | ||||
Sequence: VSVFPAADSLEQYLLELMTSVCGEDTSGPYFKKLIPYEVESLSGTLVLRWINSQLGRILSWVERAYKQEHWDPISPQQRYGSSIVEVFRIVEETVDQFFALKVPMRSIELSALFRGIDNAFQVYTNHVMEKLASKDDLVPPV | ||||||
Domain | 941-1051 | MHD2 | ||||
Sequence: QSRLEGLIEALDTELGQLCSVIMEPLRDRIVTSLLQASLDGLLRVLLDGGASRVFHPSESKLLEEDVEVLKEFFISGGDGLPRGVVENQVARVRLVVKLHGYETRELIDDL |
Sequence similarities
Belongs to the unc-13 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,101
- Mass (Da)124,523
- Last updated2002-06-01 v1
- ChecksumDB4D7A5B16131811
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB010697 EMBL· GenBank· DDBJ | BAB11155.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
CP002688 EMBL· GenBank· DDBJ | AED91091.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY090450 EMBL· GenBank· DDBJ | AAL91294.1 EMBL· GenBank· DDBJ | mRNA | ||
BT002724 EMBL· GenBank· DDBJ | AAO11640.1 EMBL· GenBank· DDBJ | mRNA |