Q8RPQ1 · DPS1_BACAN
- ProteinDNA protection during starvation protein 1
- Genedps1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids147 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Protects DNA from oxidative damage by sequestering intracellular Fe2+ ion and storing it in the form of Fe3+ oxyhydroxide mineral. One hydrogen peroxide oxidizes two Fe2+ ions, which prevents hydroxyl radical production by the Fenton Fe2+ ion (By similarity).
It is capable of binding and sequestering Fe2+ ion. Does not bind DNA.
It is capable of binding and sequestering Fe2+ ion. Does not bind DNA.
Catalytic activity
- 2 Fe2+ + 2 H+ + H2O2 = 2 Fe3+ + 2 H2O
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 29 | Fe cation 1 (UniProtKB | ChEBI); ligand shared between two dodecameric partners | ||||
Sequence: H | ||||||
Binding site | 56 | Fe cation 1 (UniProtKB | ChEBI); ligand shared between two dodecameric partners; in other chain | ||||
Sequence: D | ||||||
Binding site | 60 | Fe cation 1 (UniProtKB | ChEBI); ligand shared between two dodecameric partners; in other chain | ||||
Sequence: E | ||||||
Binding site | 60 | Fe cation 2 (UniProtKB | ChEBI) | ||||
Sequence: E |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Molecular Function | ferric iron binding | |
Molecular Function | oxidoreductase activity, acting on metal ions | |
Biological Process | intracellular iron ion homeostasis |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameDNA protection during starvation protein 1
- EC number
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageBacteria > Bacillota > Bacilli > Bacillales > Bacillaceae > Bacillus > Bacillus cereus group
Accessions
- Primary accessionQ8RPQ1
- Secondary accessions
Proteomes
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000253325 | 1-147 | DNA protection during starvation protein 1 | |||
Sequence: MSTKTNVVEVLNKQVANWNVLYVKLHNYHWYVTGPHFFTLHEKFEEFYNEAGTYIDELAERILALEGKPLATMKEYLATSSVNEGTSKESAEEMVQTLVNDYSALIQELKEGMEVAGEAGDATSADMLLAIHTTLEQHVWMLSAFLK |
Interaction
Subunit
The 12 subunits form a hollow sphere into which the mineral iron core of up to 500 Fe3+ can be deposited (By similarity).
Homododecamer
Homododecamer
Protein-protein interaction databases
Structure
Family & Domains
Sequence
- Sequence statusComplete
- Length147
- Mass (Da)16,649
- Last updated2002-06-01 v1
- Checksum2741651884FCCCCD
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF374269 EMBL· GenBank· DDBJ | AAM18636.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE016879 EMBL· GenBank· DDBJ | AAP25903.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE017334 EMBL· GenBank· DDBJ | AAT31135.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE017225 EMBL· GenBank· DDBJ | AAT54186.1 EMBL· GenBank· DDBJ | Genomic DNA |