Q8R4H4 · CBPA5_MOUSE
- ProteinCarboxypeptidase A5
- GeneCpa5
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids436 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
Cofactor
Note: Binds 1 zinc ion per subunit.
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 196 | Zn2+ (UniProtKB | ChEBI); catalytic | ||||
Sequence: H | ||||||
Binding site | 196-199 | substrate | ||||
Sequence: HSRE | ||||||
Binding site | 199 | Zn2+ (UniProtKB | ChEBI); catalytic | ||||
Sequence: E | ||||||
Binding site | 254 | substrate | ||||
Sequence: R | ||||||
Binding site | 271-272 | substrate | ||||
Sequence: NR | ||||||
Binding site | 323 | Zn2+ (UniProtKB | ChEBI); catalytic | ||||
Sequence: H | ||||||
Binding site | 324-325 | substrate | ||||
Sequence: SY | ||||||
Binding site | 375 | substrate | ||||
Sequence: Y | ||||||
Active site | 397 | Proton donor/acceptor | ||||
Sequence: E |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular space | |
Molecular Function | metallocarboxypeptidase activity | |
Molecular Function | peptidase activity | |
Molecular Function | zinc ion binding | |
Biological Process | proteolysis |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameCarboxypeptidase A5
- EC number
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ8R4H4
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for signal, propeptide, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-33 | |||||
Sequence: MQGTQRGGLVPGLSPLDRRTLLFCNFILAVAWG | ||||||
Propeptide | PRO_0000004363 | 34-126 | Activation peptide | |||
Sequence: QVNFTGDQVLRVLAKNEKQLSLLRDLETQKPQKVDFWRGPARPSLPVDMRVPFSELPSVKAYLKSHGLAYSIMIKDIQVLLDEERDAMAKSRR | ||||||
Chain | PRO_0000004364 | 127-436 | Carboxypeptidase A5 | |||
Sequence: LERSTNSFSYSSYHTLDEIYSWIDNFVAEHSNLVSKIHIGKSFENRSILVLKFSTGGPNRPAIWIDTGIHSREWITHATGIWISQKIVNAYGKDHVLKRILNTMDIFIEIVTNPDGFAFTHSMNRLWRKNKSSQPGIFCIGVDLNRNWKAGFGGNGSNKNPCSETYRGPAPESEPEVAAIVDFITGHGNFKAMISIHSYSQMVMYPYGHSLEPVPNHEELFNLAKDAVKALNKVHGIQYIFGSISTTLYSASGISVDWAYDSGIKYAFSFELRDTGQYGFLLPASQIVPTAEETWMALQTIMKHTLNHPY | ||||||
Disulfide bond | 265↔288 | |||||
Sequence: CIGVDLNRNWKAGFGGNGSNKNPC |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 138-431 | Peptidase M14 | ||||
Sequence: SYHTLDEIYSWIDNFVAEHSNLVSKIHIGKSFENRSILVLKFSTGGPNRPAIWIDTGIHSREWITHATGIWISQKIVNAYGKDHVLKRILNTMDIFIEIVTNPDGFAFTHSMNRLWRKNKSSQPGIFCIGVDLNRNWKAGFGGNGSNKNPCSETYRGPAPESEPEVAAIVDFITGHGNFKAMISIHSYSQMVMYPYGHSLEPVPNHEELFNLAKDAVKALNKVHGIQYIFGSISTTLYSASGISVDWAYDSGIKYAFSFELRDTGQYGFLLPASQIVPTAEETWMALQTIMKHT |
Sequence similarities
Belongs to the peptidase M14 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length436
- Mass (Da)49,151
- Last updated2002-06-01 v1
- Checksum798EE817B7EC21F4
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF466283 EMBL· GenBank· DDBJ | AAM19306.1 EMBL· GenBank· DDBJ | mRNA |