Q8R3J4 · MTEF3_MOUSE
- ProteinTranscription termination factor 3, mitochondrial
- GeneMterf3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids412 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
Binds promoter DNA and regulates initiation of transcription (By similarity).
Required for normal mitochondrial transcription and translation, and for normal assembly of mitochondrial respiratory complexes (PubMed:17662942, PubMed:23300484).
Required for normal mitochondrial function (PubMed:17662942, PubMed:23300484).
Maintains 16S rRNA levels and functions in mitochondrial ribosome assembly by regulating the biogenesis of the 39S ribosomal subunit (PubMed:17662942, PubMed:23300484).
Required for normal mitochondrial transcription and translation, and for normal assembly of mitochondrial respiratory complexes (PubMed:17662942, PubMed:23300484).
Required for normal mitochondrial function (PubMed:17662942, PubMed:23300484).
Maintains 16S rRNA levels and functions in mitochondrial ribosome assembly by regulating the biogenesis of the 39S ribosomal subunit (PubMed:17662942, PubMed:23300484).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | mitochondrion | |
Molecular Function | transcription cis-regulatory region binding | |
Biological Process | mitochondrial ribosome assembly | |
Biological Process | mitochondrial transcription | |
Biological Process | negative regulation of DNA-templated transcription |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameTranscription termination factor 3, mitochondrial
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ8R3J4
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Embryonic lethality, due to severe mitochondrial dysfunction. Embryos are much smaller than normal and none survive past 10.5 dpc.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 24 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for transit peptide, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transit peptide | 1-67 | Mitochondrion | ||||
Sequence: MALLAQQLPRRFNSVKLTSFIKAKQVTKRSARAGKAVLPGFSAQPLLSSDTSFLRRGIKTYRTLFWN | ||||||
Chain | PRO_0000255458 | 68-412 | Transcription termination factor 3, mitochondrial | |||
Sequence: RFHSASTNRTKSSAESTLLPSVAEQQERILSLESELPLEEVDDLPPLSPLQSVSEEEAIQIAAYSPLPISSFTLADYVDHSKTLQKLVQLGVDLSKIEKHPDAANLLLRLDFEKHIKQILLFLKDLGLEDNQLGPFLTKNYAIFSEDLENLKTRVAYLQSKNFSKTDIARMVKNAPFLLSFSVERLDNRLGFFQKELELNVKKTRDLVVRLPRLLTGSLEPVKENMKVYHLELGFKHNEIQHMVIKIPKMLTANKRKLTEIFDYVHNVMNIPHHIIVKFPQLFNTRVFKIKERHLFLAYLGRAQYDPAKPNYVSLDKFVSFPDKIFCKEIAKASLNDFEKFLKTL |
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Family & Domains
Domain
Contains seven structural repeats of about 35 residues, where each repeat contains three helices. The repeats form a superhelical structure with a solenoid shape.
Sequence similarities
Belongs to the mTERF family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length412
- Mass (Da)47,357
- Last updated2002-06-01 v1
- ChecksumE85FAACAA83E1C59
Computationally mapped potential isoform sequences
There are 7 potential isoforms mapped to this entry
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 201-203 | in Ref. 1; BAB27006 | ||||
Sequence: GPF → DTY |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK010525 EMBL· GenBank· DDBJ | BAB27006.1 EMBL· GenBank· DDBJ | mRNA | ||
AK011934 EMBL· GenBank· DDBJ | BAB27924.3 EMBL· GenBank· DDBJ | mRNA | ||
BC025173 EMBL· GenBank· DDBJ | AAH25173.1 EMBL· GenBank· DDBJ | mRNA | ||
BC085282 EMBL· GenBank· DDBJ | AAH85282.1 EMBL· GenBank· DDBJ | mRNA |