Q8QZT4 · CRUM3_MOUSE
- ProteinProtein crumbs homolog 3
- GeneCrb3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids113 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Involved in the establishment of cell polarity in mammalian epithelial cells (By similarity).
Regulates the morphogenesis of tight junctions (PubMed:21145499).
Involved in promoting phosphorylation and cytoplasmic retention of transcriptional coactivators YAP1 and WWTR1/TAZ which leads to suppression of TGFB1-dependent transcription of target genes such as CCN2/CTGF, SERPINE1/PAI1, SNAI1/SNAIL1 and SMAD7 (PubMed:21145499).
Regulates the morphogenesis of tight junctions (PubMed:21145499).
Involved in promoting phosphorylation and cytoplasmic retention of transcriptional coactivators YAP1 and WWTR1/TAZ which leads to suppression of TGFB1-dependent transcription of target genes such as CCN2/CTGF, SERPINE1/PAI1, SNAI1/SNAIL1 and SMAD7 (PubMed:21145499).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | apical part of cell | |
Cellular Component | apical plasma membrane | |
Cellular Component | bicellular tight junction | |
Cellular Component | protein-containing complex | |
Cellular Component | subapical complex | |
Molecular Function | SH3 domain binding | |
Biological Process | cell-cell junction organization | |
Biological Process | establishment of epithelial cell apical/basal polarity | |
Biological Process | positive regulation of cell junction assembly | |
Biological Process | protein localization to plasma membrane |
Names & Taxonomy
Protein names
- Recommended nameProtein crumbs homolog 3
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ8QZT4
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Apical cell membrane ; Single-pass type I membrane protein
Note: Localizes primarily to the apical membrane with a small fraction in the upper part of tight junctions of epithelial cells.
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 25-49 | Extracellular | ||||
Sequence: APDPFTNSTTQPPGDESNGGLSSGA | ||||||
Transmembrane | 50-70 | Helical | ||||
Sequence: IVAITVVFSILGVLLIAVGLF | ||||||
Topological domain | 71-113 | Cytoplasmic | ||||
Sequence: LLMRKLREKRQTEGTYRPSSEEQVGARAPPPPNLKLPPEERLI |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-24 | |||||
Sequence: MATPGLGVLLAFGLPMLPSGWSLT | ||||||
Chain | PRO_0000021006 | 25-113 | Protein crumbs homolog 3 | |||
Sequence: APDPFTNSTTQPPGDESNGGLSSGAIVAITVVFSILGVLLIAVGLFLLMRKLREKRQTEGTYRPSSEEQVGARAPPPPNLKLPPEERLI | ||||||
Glycosylation | 31 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in the apical renal tubules (at protein level) (PubMed:17920587).
Expressed in the retinal pigment epithelium (PubMed:26404741).
Expressed in the retinal pigment epithelium (PubMed:26404741).
Developmental stage
Expressed in the branchial arches, optic vesicle and mesonephric tubules of the kidney at 10.5 dpc (PubMed:17920587).
Expressed in the internal endodermal layer and in the nascent bronchial tips of the lung at 11.5 dpc (PubMed:17920587).
Expressed in the internal endodermal layer and in the nascent bronchial tips of the lung at 11.5 dpc (PubMed:17920587).
Gene expression databases
Interaction
Subunit
Component of a complex composed of CRB3, PALS1 and PATJ (By similarity).
Interacts (via C-terminus) with PALS1 (via PDZ domain) (PubMed:12527193).
Interacts with PARD6A (By similarity).
Interacts (via intracellular domain) with EPB41L5 (By similarity).
Interacts with WDR83 (By similarity).
Interacts (via C-terminus) with PALS1 (via PDZ domain) (PubMed:12527193).
Interacts with PARD6A (By similarity).
Interacts (via intracellular domain) with EPB41L5 (By similarity).
Interacts with WDR83 (By similarity).
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, compositional bias, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 23-44 | Disordered | ||||
Sequence: LTAPDPFTNSTTQPPGDESNGG | ||||||
Compositional bias | 24-42 | Polar residues | ||||
Sequence: TAPDPFTNSTTQPPGDESN | ||||||
Region | 77-113 | Interaction with EPB41L5 | ||||
Sequence: REKRQTEGTYRPSSEEQVGARAPPPPNLKLPPEERLI | ||||||
Region | 80-113 | Disordered | ||||
Sequence: RQTEGTYRPSSEEQVGARAPPPPNLKLPPEERLI | ||||||
Motif | 110-113 | PDZ-binding | ||||
Sequence: ERLI |
Domain
The PDZ-binding motif is involved in the interactions with PARD6A and PALS1.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 2 isoforms produced by Alternative splicing.
Q8QZT4-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length113
- Mass (Da)11,921
- Last updated2002-06-01 v1
- Checksum1C94A072057F1E3E
Q8QZT4-2
- Name2
- Differences from canonical
- 94-113: VGARAPPPPNLKLPPEERLI → FSHAAAEARAPQDSKEPVRGCLPI
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
E9PZ04 | E9PZ04_MOUSE | Crb3 | 62 |
Features
Showing features for compositional bias, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 24-42 | Polar residues | ||||
Sequence: TAPDPFTNSTTQPPGDESN | ||||||
Alternative sequence | VSP_013990 | 94-113 | in isoform 2 | |||
Sequence: VGARAPPPPNLKLPPEERLI → FSHAAAEARAPQDSKEPVRGCLPI |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK077528 EMBL· GenBank· DDBJ | BAC36847.1 EMBL· GenBank· DDBJ | mRNA | ||
AK167279 EMBL· GenBank· DDBJ | BAE39389.1 EMBL· GenBank· DDBJ | mRNA | ||
BC024462 EMBL· GenBank· DDBJ | AAH24462.1 EMBL· GenBank· DDBJ | mRNA | ||
CK030526 EMBL· GenBank· DDBJ | - | mRNA | No translation available. |