Q8NI17 · IL31R_HUMAN
- ProteinInterleukin-31 receptor subunit alpha
- GeneIL31RA
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids732 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Associates with OSMR to form the interleukin-31 receptor which activates STAT3 and to a lower extent STAT1 and STAT5 (PubMed:11877449, PubMed:14504285, PubMed:15194700, PubMed:15627637).
May function in skin immunity (PubMed:15184896).
Mediates IL31-induced itch, probably in a manner dependent on cation channels TRPA1 and TRPV1 (By similarity).
Positively regulates numbers and cycling status of immature subsets of myeloid progenitor cells in bone marrow in vivo and enhances myeloid progenitor cell survival in vitro (By similarity).
May function in skin immunity (PubMed:15184896).
Mediates IL31-induced itch, probably in a manner dependent on cation channels TRPA1 and TRPV1 (By similarity).
Positively regulates numbers and cycling status of immature subsets of myeloid progenitor cells in bone marrow in vivo and enhances myeloid progenitor cell survival in vitro (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameInterleukin-31 receptor subunit alpha
- Short namesIL-31 receptor subunit alpha; IL-31R subunit alpha; IL-31R-alpha; IL-31RA
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ8NI17
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Single-pass type I membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 20-519 | Extracellular | ||||
Sequence: ALPAKPENISCVYYYRKNLTCTWSPGKETSYTQYTVKRTYAFGEKHDNCTTNSSTSENRASCSFFLPRITIPDNYTIEVEAENGDGVIKSHMTYWRLENIAKTEPPKIFRVKPVLGIKRMIQIEWIKPELAPVSSDLKYTLRFRTVNSTSWMEVNFAKNRKDKNQTYNLTGLQPFTEYVIALRCAVKESKFWSDWSQEKMGMTEEEAPCGLELWRVLKPAEADGRRPVRLLWKKARGAPVLEKTLGYNIWYYPESNTNLTETMNTTNQQLELHLGGESFWVSMISYNSLGKSPVATLRIPAIQEKSFQCIEVMQACVAEDQLVVKWQSSALDVNTWMIEWFPDVDSEPTTLSWESVSQATNWTIQQDKLKPFWCYNISVYPMLHDKVGEPYSIQAYAKEGVPSEGPETKVENIGVKTVTITWKEIPKSERKGIICNYTIFYQAEGGKGFSKTVNSSILQYGLESLKRKTSYIVQVMASTSAGGTNGTSINFKTLSFSVFE | ||||||
Transmembrane | 520-540 | Helical | ||||
Sequence: IILITSLIGGGLLILIILTVA | ||||||
Topological domain | 541-732 | Cytoplasmic | ||||
Sequence: YGLKKPNKLTHLCWPTVPNPAESSIATWHGDDFKDKLNLKESDDSVNTEDRILKPCSTPSDKLVIDKLVVNFGNVLQEIFTDEARTGQENNLGGEKNGYVTCPFRPDCPLGKSFEELPVSPEIPPRKSQYLRSRMPEGTRPEAKEQLLFSGQSLVPDHLCEEGAPNPYLKNSVTAREFLVSEKLPEHTKGEV |
Keywords
- Cellular component
Disease & Variants
Involvement in disease
Amyloidosis, primary localized cutaneous, 2 (PLCA2)
- Note
- DescriptionA primary amyloidosis characterized by localized cutaneous amyloid deposition. This condition usually presents with itching (especially on the lower legs) and visible changes of skin hyperpigmentation and thickening that may be exacerbated by chronic scratching and rubbing. Primary localized cutaneous amyloidosis is often divided into macular and lichen subtypes although many affected individuals often show both variants coexisting. Lichen amyloidosis characteristically presents as a pruritic eruption of grouped hyperkeratotic papules with a predilection for the shins, calves, ankles and dorsa of feet and thighs. Papules may coalesce to form hyperkeratotic plaques that can resemble lichen planus, lichen simplex or nodular prurigo. Macular amyloidosis is characterized by small pigmented macules that may merge to produce macular hyperpigmentation, sometimes with a reticulate or rippled pattern. In macular and lichen amyloidosis, amyloid is deposited in the papillary dermis in association with grouped colloid bodies, thought to represent degenerate basal keratinocytes. The amyloid deposits probably reflect a combination of degenerate keratin filaments, serum amyloid P component, and deposition of immunoglobulins.
- See alsoMIM:613955
Natural variants in PLCA2
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_065809 | 489 | S>F | in PLCA2 |
Features
Showing features for natural variant, mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_030328 | 155 | in dbSNP:rs13184107 | |||
Sequence: D → N | ||||||
Natural variant | VAR_065809 | 489 | in PLCA2 | |||
Sequence: S → F | ||||||
Natural variant | VAR_030329 | 497 | in dbSNP:rs161704 | |||
Sequence: S → N | ||||||
Mutagenesis | 639 | No effect on STAT1 and STAT3 activation. Slight decrease; when associated with A-670 and A-708. | ||||
Sequence: Y → A | ||||||
Mutagenesis | 639 | Abrogates STAT5 activation. Mild effect on STAT1 activation. No effect on STAT3 activation. | ||||
Sequence: Y → F | ||||||
Mutagenesis | 670 | No effect on STAT1 and STAT3 activation. Slight decrease; when associated with A-639 and A-708. | ||||
Sequence: Y → A | ||||||
Mutagenesis | 670 | No effect on STAT3 and STAT5 activation. Mild effect on STAT1 activation. | ||||
Sequence: Y → F | ||||||
Mutagenesis | 708 | No effect on STAT1 and STAT3 activation. Slight decrease; when associated with A-639 and A-670. | ||||
Sequence: Y → A | ||||||
Mutagenesis | 708 | Abrogates STAT3 activation. Loss of interaction with STAT3. Mild effect on STAT1 activation. No effect on STAT5 activation. | ||||
Sequence: Y → F |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 3 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for signal, chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-19 | |||||
Sequence: MMWTWALWMLPSLCKFSLA | ||||||
Chain | PRO_0000274572 | 20-732 | Interleukin-31 receptor subunit alpha | |||
Sequence: ALPAKPENISCVYYYRKNLTCTWSPGKETSYTQYTVKRTYAFGEKHDNCTTNSSTSENRASCSFFLPRITIPDNYTIEVEAENGDGVIKSHMTYWRLENIAKTEPPKIFRVKPVLGIKRMIQIEWIKPELAPVSSDLKYTLRFRTVNSTSWMEVNFAKNRKDKNQTYNLTGLQPFTEYVIALRCAVKESKFWSDWSQEKMGMTEEEAPCGLELWRVLKPAEADGRRPVRLLWKKARGAPVLEKTLGYNIWYYPESNTNLTETMNTTNQQLELHLGGESFWVSMISYNSLGKSPVATLRIPAIQEKSFQCIEVMQACVAEDQLVVKWQSSALDVNTWMIEWFPDVDSEPTTLSWESVSQATNWTIQQDKLKPFWCYNISVYPMLHDKVGEPYSIQAYAKEGVPSEGPETKVENIGVKTVTITWKEIPKSERKGIICNYTIFYQAEGGKGFSKTVNSSILQYGLESLKRKTSYIVQVMASTSAGGTNGTSINFKTLSFSVFEIILITSLIGGGLLILIILTVAYGLKKPNKLTHLCWPTVPNPAESSIATWHGDDFKDKLNLKESDDSVNTEDRILKPCSTPSDKLVIDKLVVNFGNVLQEIFTDEARTGQENNLGGEKNGYVTCPFRPDCPLGKSFEELPVSPEIPPRKSQYLRSRMPEGTRPEAKEQLLFSGQSLVPDHLCEEGAPNPYLKNSVTAREFLVSEKLPEHTKGEV | ||||||
Glycosylation | 37 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 67 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 93 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 166 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 187 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 277 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 283 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 395 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 455 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 504 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Post-translational modification
N-glycosylated.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in CD14- and CD56-positive blood cells (PubMed:11877449).
Expressed in macrophages (PubMed:16461143, PubMed:18439099).
Expressed in keratinocytes (PubMed:21261663).
Expressed in a subset of dorsal root ganglia neurons (at protein level) (PubMed:24373353).
Expressed at low levels in testis, ovary, brain, prostate, placenta, thymus, bone marrow, trachea and skin (PubMed:11877449, PubMed:14504285, PubMed:15184896).
Expressed in bronchial and alveolar epithelial cells and pulmonary fibroblasts (PubMed:18439099).
Detected in all of the myelomonocytic lineage (PubMed:14504285).
Isoform 6: Expressed at higher levels in lesional skin compared to healthy skin of atopic dermatitis patients (PubMed:24373353).
Expressed in macrophages (PubMed:16461143, PubMed:18439099).
Expressed in keratinocytes (PubMed:21261663).
Expressed in a subset of dorsal root ganglia neurons (at protein level) (PubMed:24373353).
Expressed at low levels in testis, ovary, brain, prostate, placenta, thymus, bone marrow, trachea and skin (PubMed:11877449, PubMed:14504285, PubMed:15184896).
Expressed in bronchial and alveolar epithelial cells and pulmonary fibroblasts (PubMed:18439099).
Detected in all of the myelomonocytic lineage (PubMed:14504285).
Isoform 6: Expressed at higher levels in lesional skin compared to healthy skin of atopic dermatitis patients (PubMed:24373353).
Induction
Up-regulated in lesional keratinocytes of patients with atopic dermatitis (PubMed:16461143).
Up-regulated by IFNG/IFN-gamma (PubMed:11877449, PubMed:14504285, PubMed:15184896, PubMed:18439099, PubMed:21261663).
Up-regulated by bacterial lipopolysaccharides (LPS) (PubMed:11877449, PubMed:14504285, PubMed:15184896).
Up-regulated by triacylated lipoprotein (Pam3Cys) (PubMed:21261663).
Up-regulated by TGFB1/TGF-beta (PubMed:18439099).
Up-regulated by IFNG/IFN-gamma (PubMed:11877449, PubMed:14504285, PubMed:15184896, PubMed:18439099, PubMed:21261663).
Up-regulated by bacterial lipopolysaccharides (LPS) (PubMed:11877449, PubMed:14504285, PubMed:15184896).
Up-regulated by triacylated lipoprotein (Pam3Cys) (PubMed:21261663).
Up-regulated by TGFB1/TGF-beta (PubMed:18439099).
Gene expression databases
Organism-specific databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 24-122 | Fibronectin type-III 1 | ||||
Sequence: KPENISCVYYYRKNLTCTWSPGKETSYTQYTVKRTYAFGEKHDNCTTNSSTSENRASCSFFLPRITIPDNYTIEVEAENGDGVIKSHMTYWRLENIAKT | ||||||
Domain | 124-225 | Fibronectin type-III 2 | ||||
Sequence: PPKIFRVKPVLGIKRMIQIEWIKPELAPVSSDLKYTLRFRTVNSTSWMEVNFAKNRKDKNQTYNLTGLQPFTEYVIALRCAVKESKFWSDWSQEKMGMTEEE | ||||||
Domain | 223-315 | Fibronectin type-III 3 | ||||
Sequence: EEEAPCGLELWRVLKPAEADGRRPVRLLWKKARGAPVLEKTLGYNIWYYPESNTNLTETMNTTNQQLELHLGGESFWVSMISYNSLGKSPVAT | ||||||
Domain | 319-416 | Fibronectin type-III 4 | ||||
Sequence: PAIQEKSFQCIEVMQACVAEDQLVVKWQSSALDVNTWMIEWFPDVDSEPTTLSWESVSQATNWTIQQDKLKPFWCYNISVYPMLHDKVGEPYSIQAYA | ||||||
Domain | 421-515 | Fibronectin type-III 5 | ||||
Sequence: PSEGPETKVENIGVKTVTITWKEIPKSERKGIICNYTIFYQAEGGKGFSKTVNSSILQYGLESLKRKTSYIVQVMASTSAGGTNGTSINFKTLSF |
Sequence similarities
Belongs to the type I cytokine receptor family. Type 2 subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 12 isoforms produced by Alternative splicing.
Q8NI17-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- NoteMajor isoform. Functional IL31 receptor.
- Length732
- Mass (Da)82,954
- Last updated2002-10-01 v1
- Checksum30F84BD3DD99A20E
Q8NI17-2
- Name2
- Synonymsv3
- NoteMajor isoform. Functional IL31 receptor.
- Differences from canonical
- 1-1: M → MCIRQLKFFTTACVCECPQNILSPQPSCVNLGM
Q8NI17-3
- Name3
- Synonymsv4
Q8NI17-4
- Name4
- Synonymsv2
Q8NI17-5
- Name5
- Synonymsv1
Q8NI17-6
- Name6
- Differences from canonical
- 1-110: Missing
Q8NI17-7
- Name7
Q8NI17-8
- Name8
Q8NI17-9
- Name9
- SynonymsGPL560, short
- NoteMajor isoform. Dominant negative IL31 receptor.
Q8NI17-10
- Name10
- SynonymsGPL610
Q8NI17-11
- Name11
- SynonymsGPL626
Q8NI17-12
- Name12
- SynonymsGPL745, long
- NoteMajor isoform. Functional IL31 receptor.
- Differences from canonical
- 1-1: M → MKLSPQPSCVNLGM
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A494BZY2 | A0A494BZY2_HUMAN | IL31RA | 65 | ||
A0A499FJ31 | A0A499FJ31_HUMAN | IL31RA | 70 | ||
A0A494C190 | A0A494C190_HUMAN | IL31RA | 740 |
Sequence caution
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_022799 | 1 | in isoform 2, isoform 4, isoform 5 and isoform 8 | |||
Sequence: M → MCIRQLKFFTTACVCECPQNILSPQPSCVNLGM | ||||||
Alternative sequence | VSP_022800 | 1 | in isoform 3, isoform 7, isoform 9, isoform 10, isoform 11 and isoform 12 | |||
Sequence: M → MKLSPQPSCVNLGM | ||||||
Alternative sequence | VSP_022798 | 1-110 | in isoform 6 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_022801 | 325-732 | in isoform 4 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_022802 | 464-469 | in isoform 7 | |||
Sequence: GGKGFS → A | ||||||
Alternative sequence | VSP_022803 | 469-550 | in isoform 8 | |||
Sequence: SKTVNSSILQYGLESLKRKTSYIVQVMASTSAGGTNGTSINFKTLSFSVFEIILITSLIGGGLLILIILTVAYGLKKPNKLT → CKHAHSEVEKNPKPQIDAMDRPVVGMAPPSHCDLQPGMNHLASLNLSENGAKSTHLLGFWGLNESEVTVPERRVLRKWKELL | ||||||
Alternative sequence | VSP_022804 | 498-501 | in isoform 7 | |||
Sequence: TSAG → YSGG | ||||||
Alternative sequence | VSP_022805 | 502-732 | in isoform 7 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_022806 | 548-732 | in isoform 9 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_022807 | 551-732 | in isoform 8 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_022809 | 593-598 | in isoform 10 | |||
Sequence: LKPCST → RARYQA | ||||||
Alternative sequence | VSP_022808 | 593-613 | in isoform 11 | |||
Sequence: LKPCSTPSDKLVIDKLVVNFG → KGSELGTKLKFKPLISLDCAF | ||||||
Alternative sequence | VSP_022810 | 599-732 | in isoform 10 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_022811 | 614-732 | in isoform 11 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_022812 | 639-649 | in isoform 3 and isoform 5 | |||
Sequence: YVTCPFRPDCP → TRILSSCPTSI | ||||||
Alternative sequence | VSP_022813 | 650-732 | in isoform 3 and isoform 5 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF486620 EMBL· GenBank· DDBJ | AAM27958.1 EMBL· GenBank· DDBJ | mRNA | ||
AY499339 EMBL· GenBank· DDBJ | AAS86444.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AY499340 EMBL· GenBank· DDBJ | AAS86445.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AY499341 EMBL· GenBank· DDBJ | AAS86446.1 EMBL· GenBank· DDBJ | mRNA | ||
AY499342 EMBL· GenBank· DDBJ | AAS86447.1 EMBL· GenBank· DDBJ | mRNA | ||
AF106913 EMBL· GenBank· DDBJ | AAL36452.1 EMBL· GenBank· DDBJ | mRNA | ||
AY358117 EMBL· GenBank· DDBJ | AAQ88484.1 EMBL· GenBank· DDBJ | mRNA | ||
AY358740 EMBL· GenBank· DDBJ | AAQ89100.1 EMBL· GenBank· DDBJ | mRNA | ||
AC008914 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC110490 EMBL· GenBank· DDBJ | AAI10491.1 EMBL· GenBank· DDBJ | mRNA |