Q8NFW8 · NEUA_HUMAN
- ProteinN-acylneuraminate cytidylyltransferase
- GeneCMAS
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids434 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Catalyzes the activation of N-acetylneuraminic acid (NeuNAc) to cytidine 5'-monophosphate N-acetylneuraminic acid (CMP-NeuNAc), a substrate required for the addition of sialic acid. Has some activity toward NeuNAc, N-glycolylneuraminic acid (Neu5Gc) or 2-keto-3-deoxy-D-glycero-D-galacto-nononic acid (KDN).
Catalytic activity
- an N-acylneuraminate + CTP = a CMP-N-acyl-beta-neuraminate + diphosphate
Pathway
Amino-sugar metabolism; N-acetylneuraminate metabolism.
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 52 | substrate | ||||
Sequence: R | ||||||
Binding site | 62 | substrate | ||||
Sequence: N | ||||||
Binding site | 111 | substrate | ||||
Sequence: R | ||||||
Binding site | 120 | substrate | ||||
Sequence: S | ||||||
Binding site | 122 | substrate | ||||
Sequence: S | ||||||
Binding site | 143 | substrate | ||||
Sequence: Q | ||||||
Active site | 201 | |||||
Sequence: R |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | membrane | |
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Molecular Function | N-acylneuraminate cytidylyltransferase activity | |
Biological Process | N-acetylneuraminate metabolic process |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameN-acylneuraminate cytidylyltransferase
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ8NFW8
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 374 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for modified residue, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Modified residue | 1 | N-acetylmethionine | ||||
Sequence: M | ||||||
Chain | PRO_0000213199 | 1-434 | N-acylneuraminate cytidylyltransferase | |||
Sequence: MDSVEKGAATSVSNPRGRPSRGRPPKLQRNSRGGQGRGVEKPPHLAALILARGGSKGIPLKNIKHLAGVPLIGWVLRAALDSGAFQSVWVSTDHDEIENVAKQFGAQVHRRSSEVSKDSSTSLDAIIEFLNYHNEVDIVGNIQATSPCLHPTDLQKVAEMIREEGYDSVFSVVRRHQFRWSEIQKGVREVTEPLNLNPAKRPRRQDWDGELYENGSFYFAKRHLIEMGYLQGGKMAYYEMRAEHSVDIDVDIDWPIAEQRVLRYGYFGKEKLKEIKLLVCNIDGCLTNGHIYVSGDQKEIISYDVKDAIGISLLKKSGIEVRLISERACSKQTLSSLKLDCKMEVSVSDKLAVVDEWRKEMGLCWKEVAYLGNEVSDEECLKRVGLSGAPADACSTAQKAVGYICKCNGGRGAIREFAEHICLLMEKVNNSCQK | ||||||
Modified residue | 37 | Omega-N-methylarginine | ||||
Sequence: R | ||||||
Modified residue | 52 | Omega-N-methylarginine | ||||
Sequence: R |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Ubiquitously expressed. Expressed in pancreas, kidney, liver, skeletal muscle, lung, placenta, brain, heart, colon, PBL, small intestine, ovary, testis, prostate, thymus and spleen.
Gene expression databases
Organism-specific databases
Structure
Family & Domains
Features
Showing features for compositional bias, region, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-17 | Polar residues | ||||
Sequence: MDSVEKGAATSVSNPRG | ||||||
Region | 1-42 | Disordered | ||||
Sequence: MDSVEKGAATSVSNPRGRPSRGRPPKLQRNSRGGQGRGVEKP | ||||||
Motif | 15-31 | BC1 motif | ||||
Sequence: PRGRPSRGRPPKLQRNS | ||||||
Motif | 200-206 | BC2 motif | ||||
Sequence: KRPRRQD | ||||||
Motif | 269-276 | BC3 motif | ||||
Sequence: KEKLKEIK |
Domain
The BC2 (basic cluster 2) motif is necessary and sufficient for the nuclear localization and contains the catalytic active site. The localization in the nucleus is however not required for the enzyme activity (By similarity).
Sequence similarities
Belongs to the CMP-NeuNAc synthase family.
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q8NFW8-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length434
- Mass (Da)48,379
- Last updated2005-02-01 v2
- ChecksumB303B6647EF81A3A
Q8NFW8-2
- Name2
- Differences from canonical
- 264-434: Missing
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Features
Showing features for compositional bias, alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-17 | Polar residues | ||||
Sequence: MDSVEKGAATSVSNPRG | ||||||
Alternative sequence | VSP_012764 | 264-434 | in isoform 2 | |||
Sequence: Missing | ||||||
Sequence conflict | 396 | in Ref. 1; AAM90580 | ||||
Sequence: T → Y |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF397212 EMBL· GenBank· DDBJ | AAM90580.1 EMBL· GenBank· DDBJ | mRNA | ||
AF271388 EMBL· GenBank· DDBJ | AAF76203.1 EMBL· GenBank· DDBJ | mRNA | ||
AK022927 EMBL· GenBank· DDBJ | BAB14311.1 EMBL· GenBank· DDBJ | mRNA | ||
AL832975 EMBL· GenBank· DDBJ | CAH56346.1 EMBL· GenBank· DDBJ | mRNA | ||
BC016609 EMBL· GenBank· DDBJ | AAH16609.1 EMBL· GenBank· DDBJ | mRNA |