Q8NFT6 · DBF4B_HUMAN
- ProteinProtein DBF4 homolog B
- GeneDBF4B
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids615 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Regulatory subunit for CDC7 which activates its kinase activity thereby playing a central role in DNA replication and cell proliferation. Required for progression of S and M phases. The complex CDC7-DBF4B selectively phosphorylates MCM2 subunit at 'Ser-40' and then is involved in regulating the initiation of DNA replication during cell cycle.
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | Dbf4-dependent protein kinase complex | |
Cellular Component | intracellular membrane-bounded organelle | |
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Molecular Function | nucleic acid binding | |
Molecular Function | protein kinase activator activity | |
Molecular Function | protein kinase binding | |
Molecular Function | protein serine/threonine kinase activator activity | |
Molecular Function | zinc ion binding | |
Biological Process | positive regulation of cell population proliferation | |
Biological Process | positive regulation of G2/M transition of mitotic cell cycle | |
Biological Process | positive regulation of nuclear cell cycle DNA replication | |
Biological Process | regulation of cell cycle phase transition |
Keywords
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProtein DBF4 homolog B
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ8NFT6
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Predominantly found in soluble fraction but not in the chromatin-bound fraction.
Keywords
- Cellular component
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 620 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000317553 | 1-615 | Protein DBF4 homolog B | |||
Sequence: MSEPGKGDDCLELESSMAESRLRAPDLGVSRCLGKCQKNSPGARKHPFSGKSFYLDLPAGKNLQFLTGAIQQLGGVIEGFLSKEVSYIVSSRREVKAESSGKSHRGCPSPSPSEVRVETSAMVDPKGSHPRPSRKPVDSVPLSRGKELLQKAIRNQGSISGGGSGGSSSLLTNARSWGVRILHVDEMMMHVQQLSLASLCVKKQQPKKPEGTCPAAESRTRKVARLKAPFLKIEDESRKFRPFHHQFKSFPEISFLGPKDASPFEAPTTLGSMHHTRESKDGEPSPRSAAHTMPRRKKGYCECCQEAFEELHVHLQSAQHRSFALEAHLYAEVDRIIAQLSHSFADIPFQAGLPRWSGSPASDCDPLCPETLHPHQPSHPRAASPRIRKEDSCQASVTQGRAAGQQRWTESLDGVMGPPASHTCVSATTLLPALPKGSREQGCLCPCPASFTQSHLVTSLALLPGEWSPAEDMPLHPSQENSFAPADIPVKGPLLFPEARPWLMSARCWVRPFPFVTWGCLIPHDTTPLHEEVSPCPCLRLGYLYLLLTQSLWCRVRVPSLSTAGPIPRTSHPCTLAFPSYLNDHDLGHLCQAKPQGWNTPQPFLHCGFLAVDSG |
Post-translational modification
Phosphorylated.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Widely expressed. Highly expressed in testis.
Developmental stage
Increases as cells enter in S phase through G2/M phase. The protein has a short half-life (at protein level).
Gene expression databases
Organism-specific databases
Interaction
Subunit
Forms a complex with CDC7. Note that CDC7 forms distinct complex either with DBF4/DBF4A or DBF4B. Such complexes are stable upon replication stress.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q8NFT6 | LMO2 P25791 | 3 | EBI-749662, EBI-739696 | |
BINARY | Q8NFT6-2 | CYSRT1 A8MQ03 | 3 | EBI-12205861, EBI-3867333 | |
BINARY | Q8NFT6-2 | GEM P55040 | 3 | EBI-12205861, EBI-744104 | |
BINARY | Q8NFT6-2 | HEXIM2 Q96MH2 | 3 | EBI-12205861, EBI-5460660 | |
BINARY | Q8NFT6-2 | MDFI Q99750 | 3 | EBI-12205861, EBI-724076 | |
BINARY | Q8NFT6-2 | PCSK5 Q92824-2 | 3 | EBI-12205861, EBI-11956269 | |
BINARY | Q8NFT6-2 | ROPN1 Q9HAT0 | 6 | EBI-12205861, EBI-1378139 | |
BINARY | Q8NFT6-2 | SGF29 Q96ES7 | 3 | EBI-12205861, EBI-743117 | |
BINARY | Q8NFT6-2 | SPRED1 Q7Z699 | 3 | EBI-12205861, EBI-5235340 | |
BINARY | Q8NFT6-2 | TRIM27 P14373 | 3 | EBI-12205861, EBI-719493 | |
BINARY | Q8NFT6-2 | ZNF655 Q8N720 | 3 | EBI-12205861, EBI-625509 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, region, zinc finger, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 43-133 | BRCT | ||||
Sequence: ARKHPFSGKSFYLDLPAGKNLQFLTGAIQQLGGVIEGFLSKEVSYIVSSRREVKAESSGKSHRGCPSPSPSEVRVETSAMVDPKGSHPRPS | ||||||
Region | 93-141 | Disordered | ||||
Sequence: REVKAESSGKSHRGCPSPSPSEVRVETSAMVDPKGSHPRPSRKPVDSVP | ||||||
Region | 264-293 | Disordered | ||||
Sequence: FEAPTTLGSMHHTRESKDGEPSPRSAAHTM | ||||||
Zinc finger | 294-343 | DBF4-type | ||||
Sequence: PRRKKGYCECCQEAFEELHVHLQSAQHRSFALEAHLYAEVDRIIAQLSHS | ||||||
Region | 371-407 | Disordered | ||||
Sequence: TLHPHQPSHPRAASPRIRKEDSCQASVTQGRAAGQQR | ||||||
Compositional bias | 391-406 | Polar residues | ||||
Sequence: DSCQASVTQGRAAGQQ |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 4 isoforms produced by Alternative splicing.
Q8NFT6-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length615
- Mass (Da)67,243
- Last updated2002-10-01 v1
- Checksum02C1F957B60415A4
Q8NFT6-2
- Name2
Q8NFT6-3
- Name3
- Differences from canonical
- 1-186: Missing
- 397-615: VTQGRAAGQQRWTESLDGVMGPPASHTCVSATTLLPALPKGSREQGCLCPCPASFTQSHLVTSLALLPGEWSPAEDMPLHPSQENSFAPADIPVKGPLLFPEARPWLMSARCWVRPFPFVTWGCLIPHDTTPLHEEVSPCPCLRLGYLYLLLTQSLWCRVRVPSLSTAGPIPRTSHPCTLAFPSYLNDHDLGHLCQAKPQGWNTPQPFLHCGFLAVDSG → GIPEQDGTVDSTQAPAERAGTGEVPGPIASCQDLGVSVDVFVDPPGIPVSRSPACQCLLPSSGFMELSSGPDLALFGHKRKVQFPSGSAKKRVGASWPQASFFVPIAPNPCGTRTTSGKRLPSLPLTGHESRLLASLQPLCHSQTCLSLPDPFPWQPTDRPAEFWATQPSWLGKGWPPGPEDSECTATGPVSQEAGQLLSCPTAPGWPSAPLYSATSVQPSGAPVESRSTSLLQPLPASAGASCSRCLWAPQPLQVPCLPVSQPWSQPQPQPQPHAGRELLLRVPKVLGSSQGQAAPD
Q8NFT6-4
- Name4
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
B4E099 | B4E099_HUMAN | DBF4B | 157 |
Features
Showing features for alternative sequence, sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_031014 | 1-186 | in isoform 3 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_031015 | 157-170 | in isoform 4 | |||
Sequence: GSISGGGSGGSSSL → VSWGKMGQSRWSPA | ||||||
Alternative sequence | VSP_031016 | 171-615 | in isoform 4 | |||
Sequence: Missing | ||||||
Sequence conflict | 207 | in Ref. 2; AAL75985 | ||||
Sequence: K → R | ||||||
Sequence conflict | 352 | in Ref. 2; AAL75985 | ||||
Sequence: G → D | ||||||
Compositional bias | 391-406 | Polar residues | ||||
Sequence: DSCQASVTQGRAAGQQ | ||||||
Alternative sequence | VSP_031017 | 397-615 | in isoform 3 | |||
Sequence: VTQGRAAGQQRWTESLDGVMGPPASHTCVSATTLLPALPKGSREQGCLCPCPASFTQSHLVTSLALLPGEWSPAEDMPLHPSQENSFAPADIPVKGPLLFPEARPWLMSARCWVRPFPFVTWGCLIPHDTTPLHEEVSPCPCLRLGYLYLLLTQSLWCRVRVPSLSTAGPIPRTSHPCTLAFPSYLNDHDLGHLCQAKPQGWNTPQPFLHCGFLAVDSG → GIPEQDGTVDSTQAPAERAGTGEVPGPIASCQDLGVSVDVFVDPPGIPVSRSPACQCLLPSSGFMELSSGPDLALFGHKRKVQFPSGSAKKRVGASWPQASFFVPIAPNPCGTRTTSGKRLPSLPLTGHESRLLASLQPLCHSQTCLSLPDPFPWQPTDRPAEFWATQPSWLGKGWPPGPEDSECTATGPVSQEAGQLLSCPTAPGWPSAPLYSATSVQPSGAPVESRSTSLLQPLPASAGASCSRCLWAPQPLQVPCLPVSQPWSQPQPQPQPHAGRELLLRVPKVLGSSQGQAAPD | ||||||
Alternative sequence | VSP_031018 | 425-431 | in isoform 2 | |||
Sequence: VSATTLL → HRPCRLP | ||||||
Alternative sequence | VSP_031019 | 432-615 | in isoform 2 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF448801 EMBL· GenBank· DDBJ | AAM73808.1 EMBL· GenBank· DDBJ | mRNA | ||
AF465820 EMBL· GenBank· DDBJ | AAL75985.1 EMBL· GenBank· DDBJ | mRNA | ||
AK023149 EMBL· GenBank· DDBJ | BAB14431.1 EMBL· GenBank· DDBJ | mRNA | ||
CH471178 EMBL· GenBank· DDBJ | EAW51581.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471178 EMBL· GenBank· DDBJ | EAW51584.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471178 EMBL· GenBank· DDBJ | EAW51587.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471178 EMBL· GenBank· DDBJ | EAW51582.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471178 EMBL· GenBank· DDBJ | EAW51586.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC016158 EMBL· GenBank· DDBJ | AAH16158.1 EMBL· GenBank· DDBJ | mRNA |