Q8ND04 · SMG8_HUMAN
- ProteinNonsense-mediated mRNA decay factor SMG8
- GeneSMG8
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids991 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Involved in nonsense-mediated decay (NMD) of mRNAs containing premature stop codons. Is recruited by release factors to stalled ribosomes together with SMG1 and SMG9 (forming the SMG1C protein kinase complex) and, in the SMG1C complex, is required to mediate the recruitment of SMG1 to the ribosome:SURF complex and to suppress SMG1 kinase activity until the ribosome:SURF complex locates the exon junction complex (EJC). Acts as a regulator of kinase activity.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Biological Process | nuclear-transcribed mRNA catabolic process, nonsense-mediated decay | |
Biological Process | regulation of protein kinase activity |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameNonsense-mediated mRNA decay factor SMG8
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ8ND04
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Disease & Variants
Involvement in disease
Alzahrani-Kuwahara syndrome (ALKUS)
- Note
- DescriptionAn autosomal recessive disorder characterized by severe global developmental delay, impaired intellectual function, poor or absent speech, microcephaly, and facial dysmorphism. Additional variable features include early-onset cataracts, hypotonia, lower limb spasticity, and congenital heart malformations.
- See alsoMIM:619268
Natural variants in ALKUS
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_085550 | 208 | H>R | in ALKUS | |
VAR_085551 | 839-991 | missing | in ALKUS |
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_085550 | 208 | in ALKUS | |||
Sequence: H → R | ||||||
Natural variant | VAR_035137 | 280 | in dbSNP:rs8068240 | |||
Sequence: P → L | ||||||
Natural variant | VAR_085551 | 839-991 | in ALKUS | |||
Sequence: Missing |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 1,111 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000304974 | 1-991 | UniProt | Nonsense-mediated mRNA decay factor SMG8 | |||
Sequence: MAGPVSLRDLLMGASAWMGSESPGGSPTEGGGSAAGGPEPPWREDEICVVGIFGKTALRLNSEKFSLVNTVCDRQVFPLFRHQDPGDPGPGIRTEAGAVGEAGGAEDPGAAAGGSVRGSGAVAEGNRTEAGSQDYSLLQAYYSQESKVLYLLLTSICDNSQLLRACRALQSGEAGGGLSLPHAEAHEFWKHQEKLQCLSLLYLFSVCHILLLVHPTCSFDITYDRVFRALDGLRQKVLPLLKTAIKDCPVGKDWKLNCRPCPPRLLFLFQLNGALKVEPPRNQDPAHPDKPKKHSPKRRLQHALEDQIYRIFRKSRVLTNQSINCLFTVPANQAFVYIVPGSQEEDPVGMLLDQLRSHCTVKDPESLLVPAPLSGPRRYQVMRQHSRQQLSFHIDSSSSSSSGQLVDFTLREFLWQHVELVLSKKGFDDSVGRNPQPSHFELPTYQKWISAASKLYEVAIDGKEEDLGSPTGELTSKILSSIKVLEGFLDIDTKFSENRCQKALPMAHSAYQSNLPHNYTMTVHKNQLAQALRVYSQHARGPAFHKYAMQLHEDCYKFWSNGHQLCEERSLTDQHCVHKFHSLPKSGEKPEADRNPPVLYHNSRARSTGACNCGRKQAPRDDPFDIKAANYDFYQLLEEKCCGKLDHINFPVFEPSTPDPAPAKNESSPAPPDSDADKLKEKEPQTQGESTSLSLALSLGQSTDSLGTYPADPQAGGDNPEVHGQVEVKTEKRPNFVDRQASTVEYLPGMLHSNCPKGLLPKFSSWSLVKLGPAKSYNFHTGLDQQGFIPGTNYLMPWDIVIRTRAEDEGDLDTNSWPAPNKAIPGKRSAVVMGRGRRRDDIARAFVGFEYEDSRGRRFMCSGPDKVMKVMGSGPKESALKALNSDMPLYILSSSQGRGLKPHYAQLMRLFVVVPDAPLQIILMPQVQPGPPPCPVFYPEKQEITLPPDGLWVLRFPYAYVTERGPCFPPKENVQLMSYKVLRGVLKAVTQ | |||||||
Modified residue | 115 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 309 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue | 469 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 469 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 586 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 656 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 657 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 668 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 668 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 742 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 742 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 894 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 895 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 895 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 898 | UniProt | Omega-N-methylarginine | ||||
Sequence: R |
Post-translational modification
Phosphorylated by SMG1.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Component of the SMG1C complex composed of SMG1, SMG8 and SMG9; the recruitment of SMG8 to SMG1 N-terminus induces a large conformational change in the SMG1 C-terminal head domain containing the catalytic domain (PubMed:33205750).
Forms heterodimers with SMG9; this assembly form may represent a SMG1C intermediate form
Forms heterodimers with SMG9; this assembly form may represent a SMG1C intermediate form
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q8ND04 | SMG9 Q9H0W8 | 6 | EBI-3903643, EBI-2872322 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 16-41 | Disordered | ||||
Sequence: AWMGSESPGGSPTEGGGSAAGGPEPP | ||||||
Region | 82-127 | Disordered | ||||
Sequence: HQDPGDPGPGIRTEAGAVGEAGGAEDPGAAAGGSVRGSGAVAEGNR | ||||||
Region | 279-299 | Disordered | ||||
Sequence: PPRNQDPAHPDKPKKHSPKRR | ||||||
Region | 653-722 | Disordered | ||||
Sequence: FEPSTPDPAPAKNESSPAPPDSDADKLKEKEPQTQGESTSLSLALSLGQSTDSLGTYPADPQAGGDNPEV | ||||||
Compositional bias | 671-685 | Basic and acidic residues | ||||
Sequence: PPDSDADKLKEKEPQ | ||||||
Compositional bias | 686-709 | Polar residues | ||||
Sequence: TQGESTSLSLALSLGQSTDSLGTY |
Sequence similarities
Belongs to the SMG8 family.
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing.
Q8ND04-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length991
- Mass (Da)109,684
- Last updated2002-10-01 v1
- Checksum9D8168B171179CFF
Q8ND04-2
- Name2
- SynonymsABC2
- Differences from canonical
- 945-945: T → TLPPDGLWVLRFPYAYGLREDLVSPXGKKQEIP
Q8ND04-3
- Name3
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Sequence caution
Features
Showing features for sequence conflict, alternative sequence, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 278 | in Ref. 2; BAB15576 | ||||
Sequence: E → V | ||||||
Sequence conflict | 411 | in Ref. 2; BAB15576 | ||||
Sequence: R → W | ||||||
Sequence conflict | 488 | in Ref. 1; AAL83913 | ||||
Sequence: F → L | ||||||
Sequence conflict | 491 | in Ref. 1; AAL83913 | ||||
Sequence: I → F | ||||||
Sequence conflict | 493 | in Ref. 1; AAL83913 | ||||
Sequence: T → P | ||||||
Sequence conflict | 520 | in Ref. 1; AAL83913 | ||||
Sequence: T → P | ||||||
Sequence conflict | 522 | in Ref. 1; AAL83913 | ||||
Sequence: T → P | ||||||
Sequence conflict | 532 | in Ref. 1; AAL83913 | ||||
Sequence: L → R | ||||||
Alternative sequence | VSP_028164 | 588 | in isoform 3 | |||
Sequence: E → S | ||||||
Alternative sequence | VSP_028165 | 589-991 | in isoform 3 | |||
Sequence: Missing | ||||||
Compositional bias | 671-685 | Basic and acidic residues | ||||
Sequence: PPDSDADKLKEKEPQ | ||||||
Compositional bias | 686-709 | Polar residues | ||||
Sequence: TQGESTSLSLALSLGQSTDSLGTY | ||||||
Alternative sequence | VSP_028166 | 945 | in isoform 2 | |||
Sequence: T → TLPPDGLWVLRFPYAYGLREDLVSPXGKKQEIP |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF349467 EMBL· GenBank· DDBJ | AAL83913.1 EMBL· GenBank· DDBJ | mRNA | ||
AK001449 EMBL· GenBank· DDBJ | BAA91699.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AK026858 EMBL· GenBank· DDBJ | BAB15576.1 EMBL· GenBank· DDBJ | mRNA | ||
AL834490 EMBL· GenBank· DDBJ | CAD39148.1 EMBL· GenBank· DDBJ | mRNA | ||
AC099850 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471109 EMBL· GenBank· DDBJ | EAW94415.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC020957 EMBL· GenBank· DDBJ | AAH20957.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
BC031604 EMBL· GenBank· DDBJ | AAH31604.1 EMBL· GenBank· DDBJ | mRNA |