Q8N6P7 · I22R1_HUMAN
- ProteinInterleukin-22 receptor subunit alpha-1
- GeneIL22RA1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids574 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Component of the receptor for IL20, IL22 and IL24. Component of IL22 receptor formed by IL22RA1 and IL10RB enabling IL22 signaling via JAK/STAT pathways. IL22 also induces activation of MAPK1/MAPK3 and Akt kinases pathways. Component of one of the receptor for IL20 and IL24 formed by IL22RA1 and IL20RB also signaling through STATs activation. Mediates IL24 antiangiogenic activity as well as IL24 inhibitory effect on endothelial cell tube formation and differentiation.
Miscellaneous
Failure of medical and surgical therapy in Chronic rhinosinusitis with nasal polyps is associated with decreased expression of IL22RA1.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | plasma membrane | |
Molecular Function | cytokine receptor activity | |
Molecular Function | interferon receptor activity | |
Molecular Function | interleukin-20 binding | |
Molecular Function | interleukin-22 receptor activity | |
Biological Process | cytokine-mediated signaling pathway | |
Biological Process | defense response to Gram-negative bacterium | |
Biological Process | negative regulation of inflammatory response |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameInterleukin-22 receptor subunit alpha-1
- Short namesIL-22 receptor subunit alpha-1; IL-22R-alpha-1; IL-22RA1
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ8N6P7
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Single-pass type I membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 16-228 | Extracellular | ||||
Sequence: HAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTYGERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSAGGRSATKMTDRFSSLQHTTLKPPDVTCISKVRSIQMIVHPTPTPIRAGDGHRLTLEDIFHDLFYHLELQVNRTYQMHLGGKQREYEFFGLTPDTEFLGTIMICVPTWAKESAPYMCRVKTLPDRTWT | ||||||
Transmembrane | 229-249 | Helical | ||||
Sequence: YSFSGAFLFSMGFLVAVLCYL | ||||||
Topological domain | 250-574 | Cytoplasmic | ||||
Sequence: SYRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQYSQIRVSGPREPAGAPQRHSLSEITYLGQPDISILQPSNVPPPQILSPLSYAPNAAPEVGPPSYAPQVTPEAQFPFYAPQAISKVQPSSYAPQATPDSWPPSYGVCMEGSGKDSPTGTLSSPKHLRPKGQLQKEPPAGSCMLGGLSLQEVTSLAMEESQEAKSLHQPLGICTDRTSDPNVLHSGEEGTPQYLKGQLPLLSSVQIEGHPMSLPLQPPSRPCSPSDQGPSPWGLLESLVCPKDEAKSPAPETSDLEQPTELDSLFRGLALTVQWES |
Keywords
- Cellular component
Disease & Variants
Features
Showing features for mutagenesis, natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 58 | Strongly reduced response to IL22. | ||||
Sequence: K → A | ||||||
Mutagenesis | 60 | Loss of response to IL22. | ||||
Sequence: Y → A or R | ||||||
Natural variant | VAR_039699 | 130 | in dbSNP:rs34900099 | |||
Sequence: S → P | ||||||
Natural variant | VAR_039700 | 205 | in dbSNP:rs16829204 | |||
Sequence: V → I | ||||||
Natural variant | VAR_039701 | 209 | in dbSNP:rs34379702 | |||
Sequence: A → S | ||||||
Natural variant | VAR_039702 | 222 | in dbSNP:rs34782294 | |||
Sequence: L → P | ||||||
Natural variant | VAR_039703 | 407 | in dbSNP:rs35401673 | |||
Sequence: M → V | ||||||
Natural variant | VAR_039704 | 518 | in dbSNP:rs3795299 | |||
Sequence: R → G |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 635 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for signal, chain, disulfide bond, glycosylation, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-15 | |||||
Sequence: MRTLLTILTVGSLAA | ||||||
Chain | PRO_0000324320 | 16-574 | Interleukin-22 receptor subunit alpha-1 | |||
Sequence: HAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTYGERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSAGGRSATKMTDRFSSLQHTTLKPPDVTCISKVRSIQMIVHPTPTPIRAGDGHRLTLEDIFHDLFYHLELQVNRTYQMHLGGKQREYEFFGLTPDTEFLGTIMICVPTWAKESAPYMCRVKTLPDRTWTYSFSGAFLFSMGFLVAVLCYLSYRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQYSQIRVSGPREPAGAPQRHSLSEITYLGQPDISILQPSNVPPPQILSPLSYAPNAAPEVGPPSYAPQVTPEAQFPFYAPQAISKVQPSSYAPQATPDSWPPSYGVCMEGSGKDSPTGTLSSPKHLRPKGQLQKEPPAGSCMLGGLSLQEVTSLAMEESQEAKSLHQPLGICTDRTSDPNVLHSGEEGTPQYLKGQLPLLSSVQIEGHPMSLPLQPPSRPCSPSDQGPSPWGLLESLVCPKDEAKSPAPETSDLEQPTELDSLFRGLALTVQWES | ||||||
Disulfide bond | 71↔79 | |||||
Sequence: CQRITRKSC | ||||||
Glycosylation | 80 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 128↔217 | |||||
Sequence: CISKVRSIQMIVHPTPTPIRAGDGHRLTLEDIFHDLFYHLELQVNRTYQMHLGGKQREYEFFGLTPDTEFLGTIMICVPTWAKESAPYMC | ||||||
Glycosylation | 172 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Modified residue | 410 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 414 | Phosphoserine | ||||
Sequence: S |
Post-translational modification
Ubiquitinated.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in colon, liver, lung, pancreas and kidney. No expression in immune cells such as monocytes, T-cells, and NK-cells. Expressed in keratinocytes of normal skin as well as in psoriatic skin lesion. Detected in normal blood brain barrier endothelial cells as well as in multiple sclerosis lesions; Strongly expressed on central nervous system vessels within infiltrated multiple sclerosis lesions. Overexpressed in synovial fluid cells from rheumatoid arthritis and spondyloarthropathy patients.
Induction
By IFNG/IFN-gamma in keratinocytes.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Heterodimer with IL10RB and with IL20RB. IL22 binding to heterodimer is greater than binding to IL22RA1 alone (PubMed:11035029, PubMed:15120653, PubMed:18675809).
Interacts with FBXW12; the interaction promotes ubiquitination of IL22RA1 (PubMed:26171402).
Interacts with FBXW12; the interaction promotes ubiquitination of IL22RA1 (PubMed:26171402).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q8N6P7 | IL10RB Q08334 | 5 | EBI-3940749, EBI-11175900 | |
BINARY | Q8N6P7 | IL22 Q9GZX6 | 9 | EBI-3940749, EBI-8040250 | |
BINARY | Q8N6P7 | IL22 PRO_0000015383 Q9GZX6 | 4 | EBI-3940749, EBI-11315863 | |
BINARY | Q8N6P7 | JPH3 Q8WXH2 | 3 | EBI-3940749, EBI-1055254 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 17-124 | Fibronectin type-III 1 | ||||
Sequence: APEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTYGERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSAGGRSATKMTDRFSSLQHTTLKPP | ||||||
Domain | 141-221 | Fibronectin type-III 2 | ||||
Sequence: PTPTPIRAGDGHRLTLEDIFHDLFYHLELQVNRTYQMHLGGKQREYEFFGLTPDTEFLGTIMICVPTWAKESAPYMCRVKT | ||||||
Region | 388-440 | Disordered | ||||
Sequence: SSYAPQATPDSWPPSYGVCMEGSGKDSPTGTLSSPKHLRPKGQLQKEPPAGSC | ||||||
Region | 454-489 | Disordered | ||||
Sequence: AMEESQEAKSLHQPLGICTDRTSDPNVLHSGEEGTP | ||||||
Compositional bias | 469-483 | Polar residues | ||||
Sequence: GICTDRTSDPNVLHS | ||||||
Region | 507-560 | Disordered | ||||
Sequence: HPMSLPLQPPSRPCSPSDQGPSPWGLLESLVCPKDEAKSPAPETSDLEQPTELD |
Sequence similarities
Belongs to the type II cytokine receptor family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length574
- Mass (Da)63,077
- Last updated2002-10-01 v1
- ChecksumD46CC71D496F3420
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 117 | in Ref. 2; BAF84893 | ||||
Sequence: Q → R | ||||||
Compositional bias | 469-483 | Polar residues | ||||
Sequence: GICTDRTSDPNVLHS |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF286095 EMBL· GenBank· DDBJ | AAG22073.1 EMBL· GenBank· DDBJ | mRNA | ||
AK292204 EMBL· GenBank· DDBJ | BAF84893.1 EMBL· GenBank· DDBJ | mRNA | ||
AK313971 EMBL· GenBank· DDBJ | BAG36686.1 EMBL· GenBank· DDBJ | mRNA | ||
AL590683 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL591178 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471134 EMBL· GenBank· DDBJ | EAW95111.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC029273 EMBL· GenBank· DDBJ | AAH29273.1 EMBL· GenBank· DDBJ | mRNA |