Q8N5S9 · KKCC1_HUMAN
- ProteinCalcium/calmodulin-dependent protein kinase kinase 1
- GeneCAMKK1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids505 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Calcium/calmodulin-dependent protein kinase that belongs to a proposed calcium-triggered signaling cascade involved in a number of cellular processes. Phosphorylates CAMK1, CAMK1D, CAMK1G and CAMK4. Involved in regulating cell apoptosis. Promotes cell survival by phosphorylating AKT1/PKB that inhibits pro-apoptotic BAD/Bcl2-antagonist of cell death.
Catalytic activity
- ATP + L-seryl-[protein] = ADP + H+ + O-phospho-L-seryl-[protein]
Activity regulation
Activated by Ca2+/calmodulin. Binding of calmodulin may relieve intrasteric autoinhibition. Partially inhibited upon phosphorylation by PRCAKA/PKA (By similarity).
May be regulated through phosphorylation by CAMK1 and CAMK4
May be regulated through phosphorylation by CAMK1 and CAMK4
Features
Showing features for binding site, active site.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Cellular Component | nucleoplasm | |
Molecular Function | ATP binding | |
Molecular Function | calmodulin binding | |
Molecular Function | calmodulin-dependent protein kinase activity | |
Molecular Function | protein serine kinase activity | |
Biological Process | intracellular signal transduction |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameCalcium/calmodulin-dependent protein kinase kinase 1
- EC number
- Short namesCaM-KK 1; CaM-kinase kinase 1; CaMKK 1
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ8N5S9
- Secondary accessions
Proteomes
Organism-specific databases
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_020531 | 375 | in dbSNP:rs7214723 | |||
Sequence: E → G |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 604 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data), modified residue.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000086141 | 1-505 | UniProt | Calcium/calmodulin-dependent protein kinase kinase 1 | |||
Sequence: MEGGPAVCCQDPRAELVERVAAIDVTHLEEADGGPEPTRNGVDPPPRARAASVIPGSTSRLLPARPSLSARKLSLQERPAGSYLEAQAGPYATGPASHISPRAWRRPTIESHHVAISDAEDCVQLNQYKLQSEIGKGAYGVVRLAYNESEDRHYAMKVLSKKKLLKQYGFPRRPPPRGSQAAQGGPAKQLLPLERVYQEIAILKKLDHVNVVKLIEVLDDPAEDNLYLVFDLLRKGPVMEVPCDKPFSEEQARLYLRDVILGLEYLHCQKIVHRDIKPSNLLLGDDGHVKIADFGVSNQFEGNDAQLSSTAGTPAFMAPEAISDSGQSFSGKALDVWATGVTLYCFVYGKCPFIDDFILALHRKIKNEPVVFPEEPEISEELKDLILKMLDKNPETRIGVPDIKLHPWVTKNGEEPLPSEEEHCSVVEVTEEEVKNSVRLIPSWTTVILVKSMLRKRSFGNPFEPQARREERSMSAPGNLLVKEGFGEGGKSPELPGVQEDEAAS | |||||||
Modified residue (large scale data) | 52 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 67 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 67 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 74 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 74 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 78 | UniProt | Asymmetric dimethylarginine | ||||
Sequence: R | |||||||
Modified residue (large scale data) | 82 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 93 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 100 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 100 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 108 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 117 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 458 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 458 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 475 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 475 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 492 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 492 | PRIDE | Phosphoserine | ||||
Sequence: S |
Post-translational modification
Appears to be autophosphorylated in a Ca2+/calmodulin-dependent manner. Phosphorylated at multiple sites by PRCAKA/PKA. Phosphorylation of Ser-458 is blocked upon binding to Ca2+/calmodulin. In vitro, phosphorylated by CAMK1 and CAMK4 (By similarity).
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Interacts with CAMK4 and calmodulin.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q8N5S9 | GARRE1 O15063 | 4 | EBI-6424030, EBI-8796785 | |
BINARY | Q8N5S9 | YWHAE P62258 | 3 | EBI-6424030, EBI-356498 | |
BINARY | Q8N5S9 | YWHAH Q04917 | 7 | EBI-6424030, EBI-306940 | |
BINARY | Q8N5S9-2 | FLNA P21333-2 | 3 | EBI-25850646, EBI-9641086 | |
BINARY | Q8N5S9-2 | HSPB1 P04792 | 3 | EBI-25850646, EBI-352682 | |
BINARY | Q8N5S9-2 | HTT P42858 | 9 | EBI-25850646, EBI-466029 | |
BINARY | Q8N5S9-2 | KIF1B O60333-2 | 3 | EBI-25850646, EBI-10975473 | |
BINARY | Q8N5S9-2 | NEFL P07196 | 3 | EBI-25850646, EBI-475646 | |
BINARY | Q8N5S9-2 | PARK7 Q99497 | 3 | EBI-25850646, EBI-1164361 | |
BINARY | Q8N5S9-2 | PIAS4 Q8N2W9 | 3 | EBI-25850646, EBI-473160 | |
BINARY | Q8N5S9-2 | PRPS1 P60891 | 3 | EBI-25850646, EBI-749195 | |
BINARY | Q8N5S9-2 | RNF11 Q9Y3C5 | 3 | EBI-25850646, EBI-396669 | |
BINARY | Q8N5S9-2 | SNCA P37840 | 3 | EBI-25850646, EBI-985879 | |
BINARY | Q8N5S9-2 | SOD1 P00441 | 3 | EBI-25850646, EBI-990792 | |
BINARY | Q8N5S9-2 | WFS1 O76024 | 3 | EBI-25850646, EBI-720609 |
Protein-protein interaction databases
Chemistry
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 26-61 | Disordered | ||||
Sequence: THLEEADGGPEPTRNGVDPPPRARAASVIPGSTSRL | ||||||
Domain | 128-409 | Protein kinase | ||||
Sequence: YKLQSEIGKGAYGVVRLAYNESEDRHYAMKVLSKKKLLKQYGFPRRPPPRGSQAAQGGPAKQLLPLERVYQEIAILKKLDHVNVVKLIEVLDDPAEDNLYLVFDLLRKGPVMEVPCDKPFSEEQARLYLRDVILGLEYLHCQKIVHRDIKPSNLLLGDDGHVKIADFGVSNQFEGNDAQLSSTAGTPAFMAPEAISDSGQSFSGKALDVWATGVTLYCFVYGKCPFIDDFILALHRKIKNEPVVFPEEPEISEELKDLILKMLDKNPETRIGVPDIKLHPWV | ||||||
Region | 167-189 | RP domain | ||||
Sequence: QYGFPRRPPPRGSQAAQGGPAKQ | ||||||
Region | 435-440 | Autoinhibitory domain | ||||
Sequence: KNSVRL | ||||||
Region | 438-463 | Calmodulin-binding | ||||
Sequence: VRLIPSWTTVILVKSMLRKRSFGNPF | ||||||
Region | 460-505 | Disordered | ||||
Sequence: GNPFEPQARREERSMSAPGNLLVKEGFGEGGKSPELPGVQEDEAAS |
Domain
The autoinhibitory domain overlaps with the calmodulin binding region and may be involved in intrasteric autoinhibition.
The RP domain (arginine/proline-rich) is involved in the recognition of CAMKI and CAMK4 as substrates.
Sequence similarities
Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q8N5S9-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- SynonymsA, Variant 3
- Length505
- Mass (Da)55,735
- Last updated2004-12-07 v2
- Checksum92A055D20E487C86
Q8N5S9-2
- Name2
- SynonymsB, Variant 1
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
J3KPJ3 | J3KPJ3_HUMAN | CAMKK1 | 532 |
Features
Showing features for alternative sequence.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF425232 EMBL· GenBank· DDBJ | AAN37386.1 EMBL· GenBank· DDBJ | mRNA | ||
AF425301 EMBL· GenBank· DDBJ | AAN37387.1 EMBL· GenBank· DDBJ | mRNA | ||
AL136576 EMBL· GenBank· DDBJ | CAB66511.1 EMBL· GenBank· DDBJ | mRNA | ||
BC031647 EMBL· GenBank· DDBJ | AAH31647.1 EMBL· GenBank· DDBJ | mRNA | ||
BC043487 EMBL· GenBank· DDBJ | AAH43487.1 EMBL· GenBank· DDBJ | mRNA |