Q8N4S9 · MALD2_HUMAN
- ProteinMARVEL domain-containing protein 2
- GeneMARVELD2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids558 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Required for normal hearing via its role in the separation of the endolymphatic and perilymphatic spaces of the organ of Corti in the inner ear, and for normal survival of hair cells in the organ of Corti (PubMed:17186462).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | apical plasma membrane | |
Cellular Component | basolateral plasma membrane | |
Cellular Component | bicellular tight junction | |
Cellular Component | cell junction | |
Cellular Component | cytoplasm | |
Cellular Component | cytoplasmic vesicle | |
Cellular Component | paranodal junction | |
Cellular Component | Schmidt-Lanterman incisure | |
Cellular Component | tight junction | |
Cellular Component | tricellular tight junction | |
Biological Process | bicellular tight junction assembly | |
Biological Process | cell-cell junction organization | |
Biological Process | establishment of endothelial barrier | |
Biological Process | sensory perception of sound |
Keywords
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameMARVEL domain-containing protein 2
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ8N4S9
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-194 | Cytoplasmic | ||||
Sequence: MSNDGRSRNRDRRYDEVPSDLPYQDTTIRTHPTLHDSERAVSADPLPPPPLPLQPPFGPDFYSSDTEEPAIAPDLKPVRRFVPDSWKNFFRGKKKDPEWDKPVSDIRYISDGVECSPPASPARPNHRSPLNSCKDPYGGSEGTFSSRKEADAVFPRDPYGSLDRHTQTVRTYSEKVEEYNLRYSYMKSWAGLLR | ||||||
Transmembrane | 195-215 | Helical | ||||
Sequence: ILGVVELLLGAGVFACVTAYI | ||||||
Topological domain | 216-223 | Extracellular | ||||
Sequence: HKDSEWYN | ||||||
Transmembrane | 224-244 | Helical | ||||
Sequence: LFGYSQPYGMGGVGGLGSMYG | ||||||
Topological domain | 245-254 | Cytoplasmic | ||||
Sequence: GYYYTGPKTP | ||||||
Transmembrane | 255-275 | Helical | ||||
Sequence: FVLVVAGLAWITTIIILVLGM | ||||||
Topological domain | 276-291 | Extracellular | ||||
Sequence: SMYYRTILLDSNWWPL | ||||||
Transmembrane | 292-312 | Helical | ||||
Sequence: TEFGINVALFILYMAAAIVYV | ||||||
Topological domain | 313-319 | Cytoplasmic | ||||
Sequence: NDTNRGG | ||||||
Transmembrane | 320-337 | Helical | ||||
Sequence: LCYYPLFNTPVNAVFCRV | ||||||
Topological domain | 338-341 | Extracellular | ||||
Sequence: EGGQ | ||||||
Transmembrane | 342-362 | Helical | ||||
Sequence: IAAMIFLFVTMIVYLISALVC | ||||||
Topological domain | 363-558 | Cytoplasmic | ||||
Sequence: LKLWRHEAARRHREYMEQQEINEPSLSSKRKMCEMATSGDRQRDSEVNFKELRTAKMKPELLSGHIPPGHIPKPIVMPDYVAKYPVIQTDDERERYKAVFQDQFSEYKELSAEVQAVLRKFDELDAVMSRLPHHSESRQEHERISRIHEEFKKKKNDPTFLEKKERCDYLKNKLSHIKQRIQEYDKVMNWDVQGYS |
Keywords
- Cellular component
Disease & Variants
Involvement in disease
Deafness, autosomal recessive, 49 (DFNB49)
- Note
- DescriptionA form of non-syndromic sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information.
- See alsoMIM:610153
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_047436 | 33 | in dbSNP:rs1185246 | |||
Sequence: T → I |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 710 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data), modified residue.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000271526 | 1-558 | UniProt | MARVEL domain-containing protein 2 | |||
Sequence: MSNDGRSRNRDRRYDEVPSDLPYQDTTIRTHPTLHDSERAVSADPLPPPPLPLQPPFGPDFYSSDTEEPAIAPDLKPVRRFVPDSWKNFFRGKKKDPEWDKPVSDIRYISDGVECSPPASPARPNHRSPLNSCKDPYGGSEGTFSSRKEADAVFPRDPYGSLDRHTQTVRTYSEKVEEYNLRYSYMKSWAGLLRILGVVELLLGAGVFACVTAYIHKDSEWYNLFGYSQPYGMGGVGGLGSMYGGYYYTGPKTPFVLVVAGLAWITTIIILVLGMSMYYRTILLDSNWWPLTEFGINVALFILYMAAAIVYVNDTNRGGLCYYPLFNTPVNAVFCRVEGGQIAAMIFLFVTMIVYLISALVCLKLWRHEAARRHREYMEQQEINEPSLSSKRKMCEMATSGDRQRDSEVNFKELRTAKMKPELLSGHIPPGHIPKPIVMPDYVAKYPVIQTDDERERYKAVFQDQFSEYKELSAEVQAVLRKFDELDAVMSRLPHHSESRQEHERISRIHEEFKKKKNDPTFLEKKERCDYLKNKLSHIKQRIQEYDKVMNWDVQGYS | |||||||
Modified residue (large scale data) | 14 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 23 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 37 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 64 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 108 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 110 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 116 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 116 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 120 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 120 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 128 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 137 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 140 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 145 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 146 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 159 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue | 161 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 161 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 166 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 166 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 171 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 173 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 387 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 387 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 407 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 469 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 557 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 558 | PRIDE | Phosphoserine | ||||
Sequence: S |
Post-translational modification
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Interacts with the ubiquitin ligase ITCH (PubMed:28436082).
Interacts (via C-terminal cytoplasmic domain) with LSR (via the cytoplasmic domain), ILDR1 and ILDR2; the interaction is required to recruit MARVELD2 to tricellular contacts (By similarity).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q8N4S9 | FATE1 Q969F0 | 3 | EBI-6875061, EBI-743099 | |
BINARY | Q8N4S9 | PLG P00747 | 2 | EBI-6875061, EBI-999394 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for compositional bias, region, domain, coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-19 | Basic and acidic residues | ||||
Sequence: MSNDGRSRNRDRRYDEVPS | ||||||
Region | 1-58 | Disordered | ||||
Sequence: MSNDGRSRNRDRRYDEVPSDLPYQDTTIRTHPTLHDSERAVSADPLPPPPLPLQPPFG | ||||||
Compositional bias | 43-57 | Pro residues | ||||
Sequence: ADPLPPPPLPLQPPF | ||||||
Region | 115-145 | Disordered | ||||
Sequence: CSPPASPARPNHRSPLNSCKDPYGGSEGTFS | ||||||
Domain | 188-367 | MARVEL | ||||
Sequence: SWAGLLRILGVVELLLGAGVFACVTAYIHKDSEWYNLFGYSQPYGMGGVGGLGSMYGGYYYTGPKTPFVLVVAGLAWITTIIILVLGMSMYYRTILLDSNWWPLTEFGINVALFILYMAAAIVYVNDTNRGGLCYYPLFNTPVNAVFCRVEGGQIAAMIFLFVTMIVYLISALVCLKLWR | ||||||
Coiled coil | 439-548 | |||||
Sequence: MPDYVAKYPVIQTDDERERYKAVFQDQFSEYKELSAEVQAVLRKFDELDAVMSRLPHHSESRQEHERISRIHEEFKKKKNDPTFLEKKERCDYLKNKLSHIKQRIQEYDK | ||||||
Domain | 440-551 | OCEL | ||||
Sequence: PDYVAKYPVIQTDDERERYKAVFQDQFSEYKELSAEVQAVLRKFDELDAVMSRLPHHSESRQEHERISRIHEEFKKKKNDPTFLEKKERCDYLKNKLSHIKQRIQEYDKVMN |
Sequence similarities
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing.
Q8N4S9-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- SynonymsA, TRIC
- Length558
- Mass (Da)64,168
- Last updated2011-01-11 v2
- Checksum04F3FCB2CFDB162B
Q8N4S9-2
- Name2
- SynonymsTRICbeta
Q8N4S9-3
- Name3
- SynonymsA1
- Differences from canonical
- 383-394: Missing
Computationally mapped potential isoform sequences
There are 6 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
D6RAH8 | D6RAH8_HUMAN | MARVELD2 | 145 | ||
D6RA09 | D6RA09_HUMAN | MARVELD2 | 516 | ||
A1BQX2 | A1BQX2_HUMAN | MARVELD2 | 442 | ||
A0A0G2JQ38 | A0A0G2JQ38_HUMAN | MARVELD2 | 442 | ||
A0A0G2JN23 | A0A0G2JN23_HUMAN | MARVELD2 | 516 | ||
A0A0G2JN00 | A0A0G2JN00_HUMAN | MARVELD2 | 145 |
Features
Showing features for compositional bias, sequence conflict, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-19 | Basic and acidic residues | ||||
Sequence: MSNDGRSRNRDRRYDEVPS | ||||||
Compositional bias | 43-57 | Pro residues | ||||
Sequence: ADPLPPPPLPLQPPF | ||||||
Sequence conflict | 356 | in Ref. 3; BAF85651 | ||||
Sequence: L → P | ||||||
Alternative sequence | VSP_035760 | 383-394 | in isoform 3 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_022320 | 431-457 | in isoform 2 | |||
Sequence: GHIPKPIVMPDYVAKYPVIQTDDERER → RPANFFVFLVEMGFHRVSQDDLDLLTS | ||||||
Sequence conflict | 435 | in Ref. 3; BAF85651 | ||||
Sequence: K → R | ||||||
Alternative sequence | VSP_022321 | 458-558 | in isoform 2 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB219936 EMBL· GenBank· DDBJ | BAE54513.1 EMBL· GenBank· DDBJ | mRNA | ||
AB219937 EMBL· GenBank· DDBJ | BAE54514.1 EMBL· GenBank· DDBJ | mRNA | ||
DQ682656 EMBL· GenBank· DDBJ | ABG89104.1 EMBL· GenBank· DDBJ | mRNA | ||
DQ682657 EMBL· GenBank· DDBJ | ABG89105.1 EMBL· GenBank· DDBJ | mRNA | ||
AK055094 EMBL· GenBank· DDBJ | BAB70853.1 EMBL· GenBank· DDBJ | mRNA | ||
AK292962 EMBL· GenBank· DDBJ | BAF85651.1 EMBL· GenBank· DDBJ | mRNA | ||
AC145146 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471137 EMBL· GenBank· DDBJ | EAW51277.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC033689 EMBL· GenBank· DDBJ | AAH33689.1 EMBL· GenBank· DDBJ | mRNA |