Q8N1B9 · Q8N1B9_HUMAN
- ProteinNADH dehydrogenase (Ubiquinone) 1 alpha subcomplex, 10, 42kDa, isoform CRA_c
- GeneNDUFA10
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids201 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score1/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrion |
Keywords
- Ligand
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ8N1B9
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 250 variants from UniProt as well as other sources including ClinVar and dbSNP.
Genetic variation databases
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-15 | |||||
Sequence: MALRLLKLAATSASA | ||||||
Chain | PRO_5014312263 | 16-201 | ||||
Sequence: RVVAAGAQRVRGIHSSVQCKLRYGMWHFLLGDKASKRLTERSRVITVDGNICTGKGKLAKEIAEKLGFKHFPEAGIHYPDSTTGDGKPLATDYNGNCSLEKFYDDPRSNDGNSYRLQSWLYSSRLLQYSDALEHLLTTGQGVVLERSIFSDFVFLEAMYNQGFIRKQCESALQTHFWVCGATLQGL |
Proteomic databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 60-182 | Deoxynucleoside kinase | ||||
Sequence: ITVDGNICTGKGKLAKEIAEKLGFKHFPEAGIHYPDSTTGDGKPLATDYNGNCSLEKFYDDPRSNDGNSYRLQSWLYSSRLLQYSDALEHLLTTGQGVVLERSIFSDFVFLEAMYNQGFIRKQ |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length201
- Mass (Da)22,374
- Last updated2002-10-01 v1
- Checksum0347401B3718DA2D
Computationally mapped potential isoform sequences
There are 27 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
O95299 | NDUAA_HUMAN | NDUFA10 | 355 | ||
C9J6X0 | C9J6X0_HUMAN | NDUFA10 | 244 | ||
E7ESZ7 | E7ESZ7_HUMAN | NDUFA10 | 390 | ||
F8WEH0 | F8WEH0_HUMAN | NDUFA10 | 87 | ||
H7C2W5 | H7C2W5_HUMAN | NDUFA10 | 129 | ||
H7C2X4 | H7C2X4_HUMAN | NDUFA10 | 375 | ||
H7C1Y7 | H7C1Y7_HUMAN | NDUFA10 | 362 | ||
A0A7I2YQU0 | A0A7I2YQU0_HUMAN | NDUFA10 | 321 | ||
A0A087WXC5 | A0A087WXC5_HUMAN | NDUFA10 | 371 | ||
A0A7I2V2F6 | A0A7I2V2F6_HUMAN | NDUFA10 | 236 | ||
A0A7I2V2I6 | A0A7I2V2I6_HUMAN | NDUFA10 | 202 | ||
A0A7I2V2J5 | A0A7I2V2J5_HUMAN | NDUFA10 | 98 | ||
A0A7I2V2Q2 | A0A7I2V2Q2_HUMAN | NDUFA10 | 94 | ||
A0A7I2V327 | A0A7I2V327_HUMAN | NDUFA10 | 393 | ||
A0A7I2V2N6 | A0A7I2V2N6_HUMAN | NDUFA10 | 384 | ||
A0A7I2V2W9 | A0A7I2V2W9_HUMAN | NDUFA10 | 335 | ||
A0A7I2V2X3 | A0A7I2V2X3_HUMAN | NDUFA10 | 344 | ||
A0A7I2V3D4 | A0A7I2V3D4_HUMAN | NDUFA10 | 203 | ||
A0A7I2V3H5 | A0A7I2V3H5_HUMAN | NDUFA10 | 297 | ||
A0A7I2V438 | A0A7I2V438_HUMAN | NDUFA10 | 317 | ||
A0A7I2V458 | A0A7I2V458_HUMAN | NDUFA10 | 339 | ||
A0A7I2V419 | A0A7I2V419_HUMAN | NDUFA10 | 345 | ||
A0A7I2V4N8 | A0A7I2V4N8_HUMAN | NDUFA10 | 388 | ||
A0A7I2V594 | A0A7I2V594_HUMAN | NDUFA10 | 354 | ||
A0A7I2V5B2 | A0A7I2V5B2_HUMAN | NDUFA10 | 361 | ||
A0A7I2V5L0 | A0A7I2V5L0_HUMAN | NDUFA10 | 297 | ||
A0A7I2V5U7 | A0A7I2V5U7_HUMAN | NDUFA10 | 358 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC013469 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC114750 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC233275 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC031332 EMBL· GenBank· DDBJ | AAH31332.1 EMBL· GenBank· DDBJ | mRNA | ||
CH471063 EMBL· GenBank· DDBJ | EAW71174.1 EMBL· GenBank· DDBJ | Genomic DNA |