Q8N1A6 · CD033_HUMAN
- ProteinUPF0462 protein C4orf33
- GeneC4orf33
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids199 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameUPF0462 protein C4orf33
Gene names
Organism names
- Organism
- Taxonomic lineagecellular organisms > Eukaryota (eucaryotes) > Opisthokonta > Metazoa (metazoans) > Eumetazoa > Bilateria > Deuterostomia > Chordata (chordates) > Craniata > Vertebrata (vertebrates) > Gnathostomata (jawed vertebrates) > Teleostomi > Euteleostomi (bony vertebrates) > Sarcopterygii > Dipnotetrapodomorpha > Tetrapoda (tetrapods) > Amniota (amniotes) > Mammalia (mammals) > Theria > Eutheria (placentals) > Boreoeutheria > Euarchontoglires > Primates > Haplorrhini > Simiiformes > Catarrhini > Hominoidea (apes) > Hominidae (great apes) > Homininae > Homo
Accessions
- Primary accessionQ8N1A6
- Secondary accessions
Proteomes
Organism-specific databases
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_033334 | 40 | in dbSNP:rs35199409 | |||
Sequence: R → M | ||||||
Natural variant | VAR_033335 | 104 | in dbSNP:rs2271570 | |||
Sequence: S → L | ||||||
Natural variant | VAR_033336 | 107 | in dbSNP:rs337277 | |||
Sequence: M → V | ||||||
Natural variant | VAR_033337 | 166 | in dbSNP:rs17351999 | |||
Sequence: H → R |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 249 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000295714 | 1-199 | UPF0462 protein C4orf33 | |||
Sequence: MDFKIEHTWDGFPVKHEPVFIRLNPGDRGVMMDISAPFFRDPPAPLGEPGKPFNELWDYEVVEAFFLNDITEQYLEVELCPHGQHLVLLLSGRRNVWKQELPLSFRMSRGETKWEGKAYLPWSYFPPNVTKFNSFAIHGSKDKRSYEALYPVPQHELQQGQKPDFHCLEYFKSFNFNTLLGEEWKQPESDLWLIEKCDI |
Proteomic databases
PTM databases
Expression
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q8N1A6 | CASP6 P55212 | 3 | EBI-10264911, EBI-718729 | |
BINARY | Q8N1A6 | LAMP2 P13473-2 | 3 | EBI-10264911, EBI-21591415 | |
BINARY | Q8N1A6 | SH3GLB1 Q9Y371 | 3 | EBI-10264911, EBI-2623095 | |
BINARY | Q8N1A6 | TRIP13 Q15645 | 7 | EBI-10264911, EBI-358993 | |
BINARY | Q8N1A6 | VAC14 Q08AM6 | 8 | EBI-10264911, EBI-2107455 |
Protein-protein interaction databases
Miscellaneous
Structure
Sequence
- Sequence statusComplete
- Length199
- Mass (Da)23,468
- Last updated2010-05-18 v2
- Checksum797E0259540AFAA4
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 130 | in Ref. 1; BAC03568 | ||||
Sequence: T → A | ||||||
Sequence conflict | 159 | in Ref. 5; AAH16358 | ||||
Sequence: Q → R |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK091022 EMBL· GenBank· DDBJ | BAC03568.1 EMBL· GenBank· DDBJ | mRNA | ||
BX538164 EMBL· GenBank· DDBJ | CAD98044.1 EMBL· GenBank· DDBJ | mRNA | ||
AC093826 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471056 EMBL· GenBank· DDBJ | EAX05162.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471056 EMBL· GenBank· DDBJ | EAX05166.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC016358 EMBL· GenBank· DDBJ | AAH16358.1 EMBL· GenBank· DDBJ | mRNA | ||
BC032582 EMBL· GenBank· DDBJ | AAH32582.1 EMBL· GenBank· DDBJ | mRNA |