Q8MX40 · IDGF1_DROYA
- ProteinChitinase-like protein Idgf1
- GeneIdgf1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids439 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Cooperates with insulin-like peptides to stimulate the proliferation, polarization and motility of imaginal disk cells. May act by stabilizing the binding of insulin-like peptides to its receptor through a simultaneous interaction with both molecules to form a multiprotein signaling complex (By similarity).
Miscellaneous
Lacks the typical Glu active site in position 150 that is replaced by a Gln residue, preventing the hydrolase activity. Its precise function remains unclear.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Molecular Function | chitin binding | |
Molecular Function | imaginal disc growth factor receptor binding | |
Biological Process | carbohydrate metabolic process | |
Biological Process | chitin-based cuticle development | |
Biological Process | ecdysis, chitin-based cuticle | |
Biological Process | epithelium regeneration | |
Biological Process | imaginal disc development | |
Biological Process | regulation of stem cell division | |
Biological Process | wound healing |
Keywords
- Molecular function
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameChitinase-like protein Idgf1
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionQ8MX40
Subcellular Location
UniProt Annotation
GO Annotation
Note: Secreted in hemolymph. It is probably transported to target tissues via hemolymph.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain, disulfide bond, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-20 | |||||
Sequence: MRFQLCYLLGLLSVTSLSHA | ||||||
Chain | PRO_0000011982 | 21-439 | Chitinase-like protein Idgf1 | |||
Sequence: ASNLICYYDSTSYLRQGLAKMHTHELDLALQFCTHLVYGYAGLKAGTLELFSLNVDLDMFYYKEITALRQKFPQLKILLSVGGDRDVDEAHPNKYVELLEANRTFQQNFIDSSMILVKRNGFDGLDLAFQLPRNKPRKVHGSLGTYWKSFKKLFTGDFVVDPLAEQHKSQFTDLVGNLKNAFRSANLMLSLTVLPNVNSTWYFDVPKLHPQFEYINLAAFDFLTPVRNPEEADFTAPIFFQDEQNRLPHLNVEFQVNYWLQNNCPGQKLNLGIASYGRAWKLSKGSGLSGAPIVQETCGAAPGGIQIQSADGLLSWPEICSKLSQNASAQYRGEMAPLRKVTDLTQKYGNYALRPADDNGDFGVWLSFDDPDFAGIKAAYAKGKGLGGVAIFDLSYDDFRGLCTGQKFPIVRSIKYFMG | ||||||
Disulfide bond | 26↔53 | |||||
Sequence: CYYDSTSYLRQGLAKMHTHELDLALQFC | ||||||
Glycosylation | 122 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 218 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 340↔423 | |||||
Sequence: CSKLSQNASAQYRGEMAPLRKVTDLTQKYGNYALRPADDNGDFGVWLSFDDPDFAGIKAAYAKGKGLGGVAIFDLSYDDFRGLC | ||||||
Glycosylation | 346 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Post-translational modification
Glycosylated.
Keywords
- PTM
PTM databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 22-439 | GH18 | ||||
Sequence: SNLICYYDSTSYLRQGLAKMHTHELDLALQFCTHLVYGYAGLKAGTLELFSLNVDLDMFYYKEITALRQKFPQLKILLSVGGDRDVDEAHPNKYVELLEANRTFQQNFIDSSMILVKRNGFDGLDLAFQLPRNKPRKVHGSLGTYWKSFKKLFTGDFVVDPLAEQHKSQFTDLVGNLKNAFRSANLMLSLTVLPNVNSTWYFDVPKLHPQFEYINLAAFDFLTPVRNPEEADFTAPIFFQDEQNRLPHLNVEFQVNYWLQNNCPGQKLNLGIASYGRAWKLSKGSGLSGAPIVQETCGAAPGGIQIQSADGLLSWPEICSKLSQNASAQYRGEMAPLRKVTDLTQKYGNYALRPADDNGDFGVWLSFDDPDFAGIKAAYAKGKGLGGVAIFDLSYDDFRGLCTGQKFPIVRSIKYFMG |
Sequence similarities
Belongs to the glycosyl hydrolase 18 family. IDGF subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length439
- Mass (Da)49,244
- Last updated2002-10-01 v1
- ChecksumEDE16BFD82A18B9E