Q8MUC5 · CU36_MANSE
- ProteinPupal cuticle protein 36
- GenePCP36
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids342 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Component of the pupal abdominal endocuticle. May have important role in the larval and adult exoskeleton structure.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chitin-based extracellular matrix | |
Molecular Function | structural constituent of chitin-based larval cuticle |
Names & Taxonomy
Protein names
- Recommended namePupal cuticle protein 36
- Alternative names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Lepidoptera > Glossata > Ditrysia > Bombycoidea > Sphingidae > Sphinginae > Sphingini > Manduca
Accessions
- Primary accessionQ8MUC5
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-15 | |||||
Sequence: MKLFVLAAVLGVCLA | ||||||
Chain | PRO_0000006412 | 16-342 | Pupal cuticle protein 36 | |||
Sequence: DRLDNKYLPPRGNAGAGFGPGFGGAGPKGGGSGFGGAGSGFGGAGSGFGGAGSGFGGGAGGAFGHGGAGSGFGGQAGGYSGAGGAGGYSGGASGQYSGRGGAASADANAQILRLNNEVTAEGFAYDFETSNGIRADAQGVATNGVQSQGSFAYKGDDGQDYSITYTADENGFVPQGAHLPTPPPIPEEILKSLEQNARDEAAGIVDDGTYRGEGAGAGVAGGYSGAGGYSGGAGGAGGFGAGGAGRAGGAGGFGTGGAGRAGGAGGFGAGGAGGAGGAGGFGAGAGGFGGRGSGGFGGAASRQYLAPNAGGRGSGSGNFNAQTGYQY |
Expression
Developmental stage
Present at low levels early in the fifth larval stadium, followed by a large increase in abundance prior to pupal ecdysis. Also present at low levels in adults.
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 135-198 | Chitin-binding type R&R | ||||
Sequence: AEGFAYDFETSNGIRADAQGVATNGVQSQGSFAYKGDDGQDYSITYTADENGFVPQGAHLPTPP | ||||||
Region | 322-342 | Disordered | ||||
Sequence: PNAGGRGSGSGNFNAQTGYQY | ||||||
Compositional bias | 328-342 | Polar residues | ||||
Sequence: GSGSGNFNAQTGYQY |
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length342
- Mass (Da)31,168
- Last updated2002-10-01 v1
- Checksum181C679197C07AB0
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 201 | in Ref. 1; AA sequence | ||||
Sequence: P → I | ||||||
Sequence conflict | 234 | in Ref. 1; AA sequence | ||||
Sequence: V → G | ||||||
Sequence conflict | 270 | in Ref. 1; AA sequence | ||||
Sequence: T → A | ||||||
Compositional bias | 328-342 | Polar residues | ||||
Sequence: GSGSGNFNAQTGYQY |
Mass Spectrometry
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF526296 EMBL· GenBank· DDBJ | AAM88288.1 EMBL· GenBank· DDBJ | mRNA |