Q8MM24 · IDGF1_DROME
- ProteinChitinase-like protein Idgf1
- GeneIdgf1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids439 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Cooperates with insulin-like peptides to stimulate the proliferation, polarization and motility of imaginal disk cells. May act by stabilizing the binding of insulin-like peptides to its receptor through a simultaneous interaction with both molecules to form a multiprotein signaling complex.
Miscellaneous
Lacks the typical Glu active site in position 150 that is replaced by a Gln residue, preventing the hydrolase activity. Its precise function remains unclear.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Molecular Function | chitin binding | |
Molecular Function | imaginal disc growth factor receptor binding | |
Biological Process | carbohydrate metabolic process | |
Biological Process | chitin catabolic process | |
Biological Process | chitin-based cuticle development | |
Biological Process | ecdysis, chitin-based cuticle | |
Biological Process | epithelium regeneration | |
Biological Process | imaginal disc development | |
Biological Process | regulation of stem cell division | |
Biological Process | wound healing |
Keywords
- Molecular function
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameChitinase-like protein Idgf1
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionQ8MM24
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Secreted in hemolymph. It is probably transported to target tissues via hemolymph.
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | 8 | in strain: MB15b and MB25a | ||||
Sequence: I → L | ||||||
Natural variant | 44 | in strain: MB13a, MB15b, MB25a, MB34a, MB37a and MB63a | ||||
Sequence: N → S | ||||||
Natural variant | 100 | in strain: MB01a and MB33a | ||||
Sequence: S → G | ||||||
Natural variant | 116 | in strain: MB08b, MB29b, MB36a, MB40b, MB47a, MB48b, MB52b and MB58b | ||||
Sequence: V → I | ||||||
Natural variant | 186 | in strain: MB08b, MB29b, MB40b, MB45b, MB47a, MB48b, MB52b and MB80b | ||||
Sequence: E → Q | ||||||
Natural variant | 305 | in strain: MB01a, MB08b, MB29b, MB36a, MB45b, MB47a, MB48b and MB52b and MB80b | ||||
Sequence: G → E | ||||||
Natural variant | 313 | in strain: MB48b and MB52b | ||||
Sequence: I → V | ||||||
Natural variant | 399 | in strain: MB34a and MB39b | ||||
Sequence: V → E | ||||||
Natural variant | 403 | in strain: MB08b, MB15b, MB25a, MB29b, MB33a, MB34a, MB36a, MB39b, MB45b, MB46b, MB47a, MB48b, MB52b, MB58b, MB63a and MB80b | ||||
Sequence: G → S |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 9 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for signal, chain, disulfide bond, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-20 | |||||
Sequence: MRFQLFYILGLLSVTSLTHA | ||||||
Chain | PRO_0000011980 | 21-439 | Chitinase-like protein Idgf1 | |||
Sequence: ASNLICYYDSNSYLRQGLAKMHTNELDLALQFCTHLVYGYAGLKSGTLELFSLNVDLDMFYYKDITALRQKFPQLKILLSVGGDRDVDEAHPNKYVELLEANRTAQQNFIDSSMILLKRNGFDGLDLAFQLPRNKPRKVHGSLGSYWKSFKKLFTGDFVVDPQAEEHKSQFTDLVGNIKNAFRSANLMLSLTVLPNVNSTWYFDVPKLHPQFDYINLAAFDFLTPLRNPEEADFTAPIFFQDEQNRLPHLNVEFQINYWLQNHCPGQKLNLGIASYGRAWKLSKGSGLSGAPIVHETCGVAPGGIQIQSAEGLLSWPEICSKLSQNASAQYRGELAPLRKVTDLTQKYGNYALRPADDNGDFGVWLSFDDPDFAGIKAVYAKGKGLGGIALFDLSYDDFRGLCTGQKYPILRSIKYFMG | ||||||
Disulfide bond | 26↔53 | |||||
Sequence: CYYDSNSYLRQGLAKMHTNELDLALQFC | ||||||
Glycosylation | 122 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 218 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 340↔423 | |||||
Sequence: CSKLSQNASAQYRGELAPLRKVTDLTQKYGNYALRPADDNGDFGVWLSFDDPDFAGIKAVYAKGKGLGGIALFDLSYDDFRGLC | ||||||
Glycosylation | 346 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Primarily expressed in yolk cells and fat body. In larvae, it is expressed in large salivary gland cells and weakly expressed in imaginal disks. Less expressed than Idgf2 and Idgf4.
Developmental stage
Expressed both maternally and zygotically. Expressed throughout development, with a much stronger expression during larval stages.
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 22-439 | GH18 | ||||
Sequence: SNLICYYDSNSYLRQGLAKMHTNELDLALQFCTHLVYGYAGLKSGTLELFSLNVDLDMFYYKDITALRQKFPQLKILLSVGGDRDVDEAHPNKYVELLEANRTAQQNFIDSSMILLKRNGFDGLDLAFQLPRNKPRKVHGSLGSYWKSFKKLFTGDFVVDPQAEEHKSQFTDLVGNIKNAFRSANLMLSLTVLPNVNSTWYFDVPKLHPQFDYINLAAFDFLTPLRNPEEADFTAPIFFQDEQNRLPHLNVEFQINYWLQNHCPGQKLNLGIASYGRAWKLSKGSGLSGAPIVHETCGVAPGGIQIQSAEGLLSWPEICSKLSQNASAQYRGELAPLRKVTDLTQKYGNYALRPADDNGDFGVWLSFDDPDFAGIKAVYAKGKGLGGIALFDLSYDDFRGLCTGQKYPILRSIKYFMG |
Sequence similarities
Belongs to the glycosyl hydrolase 18 family. IDGF subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length439
- Mass (Da)49,376
- Last updated2004-03-15 v2
- Checksum8CBE7CA0A1D59179
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 264 | in Ref. 1; AAC99417 | ||||
Sequence: Q → E | ||||||
Sequence conflict | 396 | in Ref. 1; AAC99417 | ||||
Sequence: I → L |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF102236 EMBL· GenBank· DDBJ | AAC99417.1 EMBL· GenBank· DDBJ | mRNA | ||
AF394691 EMBL· GenBank· DDBJ | AAM69623.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF394692 EMBL· GenBank· DDBJ | AAM69624.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF394693 EMBL· GenBank· DDBJ | AAM69625.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF394694 EMBL· GenBank· DDBJ | AAM69626.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF394695 EMBL· GenBank· DDBJ | AAM69627.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF394696 EMBL· GenBank· DDBJ | AAM69628.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF394697 EMBL· GenBank· DDBJ | AAM69629.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF394698 EMBL· GenBank· DDBJ | AAM69630.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF394699 EMBL· GenBank· DDBJ | AAM69631.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF394700 EMBL· GenBank· DDBJ | AAM69632.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF394701 EMBL· GenBank· DDBJ | AAM69633.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF394702 EMBL· GenBank· DDBJ | AAM69634.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF394703 EMBL· GenBank· DDBJ | AAM69635.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF394704 EMBL· GenBank· DDBJ | AAM69636.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF394705 EMBL· GenBank· DDBJ | AAM69637.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF394706 EMBL· GenBank· DDBJ | AAM69638.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF394707 EMBL· GenBank· DDBJ | AAM69639.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF394708 EMBL· GenBank· DDBJ | AAM69640.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF394709 EMBL· GenBank· DDBJ | AAM69641.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF394710 EMBL· GenBank· DDBJ | AAM69642.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014134 EMBL· GenBank· DDBJ | AAF53535.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY069157 EMBL· GenBank· DDBJ | AAL39302.1 EMBL· GenBank· DDBJ | mRNA |