Q8LQH4 · LBD6_ORYSJ
- ProteinLOB domain-containing protein 6
- GeneLBD6
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids269 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score2/5
Function
function
Negative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation (By similarity).
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameLOB domain-containing protein 6
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ8LQH4
- Secondary accessions
Proteomes
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000299140 | 1-269 | LOB domain-containing protein 6 | |||
Sequence: MASSSASSVPAPSGSVITIASASASAAANTAACGTGSPCAACKFLRRKCQPDCVFAPYFPPDNPQKFVHVHRVFGASNVTKLLNELHPYQREDAVNSLAYEADMRLRDPVYGCVAIISILQRNLRQLQQDLARAKFELSKYQQAAAAAAAASASTGTNNGPHSMAEFIGNAVPNGAQSFINVGHSAALASVGGAAACFGQEQQFSAVHMLSRSYEGEPIARLGGNGGYEFGYSTSMAGGGHMSGLGALGGAPFLKSGIAGSDERQGAGQ |
Proteomic databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 37-138 | LOB | ||||
Sequence: SPCAACKFLRRKCQPDCVFAPYFPPDNPQKFVHVHRVFGASNVTKLLNELHPYQREDAVNSLAYEADMRLRDPVYGCVAIISILQRNLRQLQQDLARAKFEL |
Sequence similarities
Belongs to the LOB domain-containing protein family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length269
- Mass (Da)27,622
- Last updated2002-10-01 v1
- Checksum4A6C5E1B04B6DF64
Sequence caution
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 1-5 | in Ref. 2; ABU44494 | ||||
Sequence: MASSS → MGVHRQ |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB200237 EMBL· GenBank· DDBJ | BAD88526.1 EMBL· GenBank· DDBJ | mRNA | ||
EF540766 EMBL· GenBank· DDBJ | ABU44494.1 EMBL· GenBank· DDBJ | mRNA | ||
AP003431 EMBL· GenBank· DDBJ | BAB92647.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP008207 EMBL· GenBank· DDBJ | BAF06960.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP014957 EMBL· GenBank· DDBJ | BAS75644.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CM000138 EMBL· GenBank· DDBJ | EEE55782.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
AK071407 EMBL· GenBank· DDBJ | BAG92480.1 EMBL· GenBank· DDBJ | mRNA | ||
AK119575 EMBL· GenBank· DDBJ | BAG99700.1 EMBL· GenBank· DDBJ | mRNA |