Q8LHP0 · ELOF1_ORYSJ
- ProteinTranscription elongation factor 1 homolog
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Transcription elongation factor implicated in the maintenance of proper chromatin structure in actively transcribed regions.
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | transcription elongation factor complex | |
Molecular Function | metal ion binding | |
Molecular Function | RNA polymerase II complex binding | |
Biological Process | transcription elongation by RNA polymerase II |
Keywords
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameTranscription elongation factor 1 homolog
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ8LHP0
- Secondary accessions
Proteomes
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000120947 | 1-89 | Transcription elongation factor 1 homolog | |||
Sequence: MGKRKSAAKPPPKKRMDKLDTVFSCPFCNHGSSVECRIDMKNLIGEASCRICQENFSTTVNALTEPIDIYSEWIDECERVNNVEDDDGA |
Proteomic databases
Interaction
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Length89
- Mass (Da)10,000
- Last updated2002-10-01 v1
- Checksum28EF24F0AB93B89F
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AP004339 EMBL· GenBank· DDBJ | BAC10134.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP008213 EMBL· GenBank· DDBJ | BAF22274.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP014963 EMBL· GenBank· DDBJ | BAT02772.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CM000144 EMBL· GenBank· DDBJ | EAZ40760.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK061633 EMBL· GenBank· DDBJ | - | mRNA | No translation available. |