Q8LFX7 · BDG1_ARATH
- ProteinProbable lysophospholipase BODYGUARD 1
- GeneBDG1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids469 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Controls cuticle development and morphogenesis, by promoting cutin and suberin monomers loading (PubMed:16415209, PubMed:17257167, PubMed:18952782, PubMed:26990896).
Involved in the regulation of abscissic acid (ABA) biosynthesis in response to osmotic stress. Plays an important role in osmotic stress and drought resistance (PubMed:21610183).
Required to ensure a reduced permeability of aerial tissue, thus preventing transpiration (PubMed:18952782, PubMed:21610183, PubMed:26990896).
Regulates lateral root hair development (PubMed:18952782).
Involved in the regulation of abscissic acid (ABA) biosynthesis in response to osmotic stress. Plays an important role in osmotic stress and drought resistance (PubMed:21610183).
Required to ensure a reduced permeability of aerial tissue, thus preventing transpiration (PubMed:18952782, PubMed:21610183, PubMed:26990896).
Regulates lateral root hair development (PubMed:18952782).
Required for infection by the pathogenic necrotrophic fungus Botrytis cinerea, probably by regulating structural traits of the cuticle.
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 189 | |||||
Sequence: H | ||||||
Active site | 263 | Nucleophile | ||||
Sequence: S | ||||||
Active site | 410 | Charge relay system | ||||
Sequence: D | ||||||
Active site | 438 | Charge relay system | ||||
Sequence: H |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Cellular Component | plant-type cell wall | |
Cellular Component | plasma membrane | |
Molecular Function | hydrolase activity | |
Biological Process | abscisic acid biosynthetic process | |
Biological Process | cell wall organization | |
Biological Process | cuticle development | |
Biological Process | cutin biosynthetic process | |
Biological Process | defense response to fungus | |
Biological Process | lateral root development | |
Biological Process | positive regulation of cutin biosynthetic process | |
Biological Process | positive regulation of response to water deprivation | |
Biological Process | regulation of abscisic acid biosynthetic process | |
Biological Process | response to abscisic acid | |
Biological Process | response to osmotic stress | |
Biological Process | suberin biosynthetic process | |
Biological Process | transpiration |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameProbable lysophospholipase BODYGUARD 1
- EC number
- Short namesAtBDG1
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ8LFX7
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Lipid-anchor
Note: Polar localization with accumulation in epidermis outermost cell wall.
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Defects characteristic of the loss of cuticle structure associated with an enhanced accumulation of cell wall-bound lipids and epicuticular waxes (PubMed:16415209, PubMed:17257167, PubMed:18952782, PubMed:26990896).
Reduced expression of abscissic acid (ABA) biosynthesis genes (e.g. NCED3) in response to osmotic stress (e.g. polyethylene glycol) leading to reduced levels of ABA and high sensitivity to osmotic stress and drought, especially during seed germination and early seedling development (PubMed:21610183).
Increased aerial tissue permeability to the toluidine blue (TB) dye (PubMed:18952782).
Enhanced transpiration. Strong decrease in total cutin monomer load in young leaves and flowers. Reduced levels of suberin in roots (PubMed:26990896).
Pleiotropic effect on growth, viability, and cell differentiation, leading to abnormalities such as long root hairs, excessively branched roots, shrinking of epidermal cells, and flattened/misshapen trichomes (PubMed:16415209).
Strong increase of total lateral root lengths (TOT) on mild osmotic stress conditions (PubMed:18952782).
Total immunity to the pathogenic necrotrophic fungus Botrytis cinerea accompanied by the release of a fungitoxic activity and increased expression of defense genes (PubMed:17257167).
Reduced expression of abscissic acid (ABA) biosynthesis genes (e.g. NCED3) in response to osmotic stress (e.g. polyethylene glycol) leading to reduced levels of ABA and high sensitivity to osmotic stress and drought, especially during seed germination and early seedling development (PubMed:21610183).
Increased aerial tissue permeability to the toluidine blue (TB) dye (PubMed:18952782).
Enhanced transpiration. Strong decrease in total cutin monomer load in young leaves and flowers. Reduced levels of suberin in roots (PubMed:26990896).
Pleiotropic effect on growth, viability, and cell differentiation, leading to abnormalities such as long root hairs, excessively branched roots, shrinking of epidermal cells, and flattened/misshapen trichomes (PubMed:16415209).
Strong increase of total lateral root lengths (TOT) on mild osmotic stress conditions (PubMed:18952782).
Total immunity to the pathogenic necrotrophic fungus Botrytis cinerea accompanied by the release of a fungitoxic activity and increased expression of defense genes (PubMed:17257167).
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 17 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for signal, lipidation, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-45 | |||||
Sequence: MGFSRSLNRTVGVFVFFILDIVDFLLCFTYKTLDFFFESEWKPCY | ||||||
Lipidation | 46 | N-palmitoyl cysteine | ||||
Sequence: C | ||||||
Chain | PRO_0000437268 | 46-469 | Probable lysophospholipase BODYGUARD 1 | |||
Sequence: CCPPPEAKPISAGGNRGGKMIVSERSGDYSKVVSLTRTKIYLDEISDTLYSRPSLLTKLTKLVKCFKKDVVKCCDESKKRSPSTKKTLLTVNSTVVEKLQRTPRWSDCHCTFCTSWLSSSNQSLFVNVQQPTDNKAQENVVFIHGFLSSSTFWTETLFPNFSDSAKSNYRFLAVDLLGYGKSPKPNDSLYTLKEHLEMIERSVISQFRLKTFHLVAHSLGCILALALAVKHPGAIKSLTLLAPPYYSVPKGVQGTQYVMRRLAPKEVWPPMAFGASVASWYEHISRTVSLVLCKNHHLLEFLTRLLTRNRMRTYLIEGFLCHTHNASWHTLHNIIFGSGSKVEAYLDHVRDNVDCEVAVFHGGRDELIPVECSYGVKRKVPRARIHVVPDKDHITIVVGRQKEFARELELIWRRSTTPQLHSIN |
Keywords
- PTM
Proteomic databases
Expression
Tissue specificity
Expressed exclusively in protodermal and epidermal cells of all organs, especially on adaxial sides.
Induction
Induced by osmotic stress and abscissic acid (ABA).
Developmental stage
In germinating seed, present in the embryo epidermis, in cotyledons and in leaf primordia of the first true leaves. In cotyledons, mostly expressed in guard cells and vasculature. Observed in developing leaf buds, including the nodes and buds of cauline leaves (PubMed:26990896).
In flowers, expressed in all organs, levels decreasing during flower aging. In the pistil, accumulates mostly in the abaxial epidermal cells, and, to a lower extent, in the septum and the inner ovary wall (PubMed:16415209, PubMed:26990896).
Also expressed in the stigmatic papillae and vasculature of the sepals, petals and stamens. Accumulates in embryo during seed dehydration. Present in the central cylinder of the roots. In addition, detected in suberized tissues, such as siliques abscission zone and seed chalaza/micropyle region (PubMed:26990896).
In flowers, expressed in all organs, levels decreasing during flower aging. In the pistil, accumulates mostly in the abaxial epidermal cells, and, to a lower extent, in the septum and the inner ovary wall (PubMed:16415209, PubMed:26990896).
Also expressed in the stigmatic papillae and vasculature of the sepals, petals and stamens. Accumulates in embryo during seed dehydration. Present in the central cylinder of the roots. In addition, detected in suberized tissues, such as siliques abscission zone and seed chalaza/micropyle region (PubMed:26990896).
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 185-439 | AB hydrolase-1 | ||||
Sequence: VVFIHGFLSSSTFWTETLFPNFSDSAKSNYRFLAVDLLGYGKSPKPNDSLYTLKEHLEMIERSVISQFRLKTFHLVAHSLGCILALALAVKHPGAIKSLTLLAPPYYSVPKGVQGTQYVMRRLAPKEVWPPMAFGASVASWYEHISRTVSLVLCKNHHLLEFLTRLLTRNRMRTYLIEGFLCHTHNASWHTLHNIIFGSGSKVEAYLDHVRDNVDCEVAVFHGGRDELIPVECSYGVKRKVPRARIHVVPDKDHI |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length469
- Mass (Da)53,428
- Last updated2002-10-01 v1
- Checksum7DBCBBB9D8B58B58
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1P8AWW6 | A0A1P8AWW6_ARATH | BDG1 | 524 | ||
A0A1P8AX04 | A0A1P8AX04_ARATH | BDG1 | 516 |
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AJ781319 EMBL· GenBank· DDBJ | CAH03662.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AC009519 EMBL· GenBank· DDBJ | AAF19684.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
CP002684 EMBL· GenBank· DDBJ | AEE34272.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK119137 EMBL· GenBank· DDBJ | BAC43707.1 EMBL· GenBank· DDBJ | mRNA | ||
BT005382 EMBL· GenBank· DDBJ | AAO63446.1 EMBL· GenBank· DDBJ | mRNA | ||
AY084590 EMBL· GenBank· DDBJ | AAM61155.1 EMBL· GenBank· DDBJ | mRNA |