Q8LFG1 · AMY2_ARATH
- ProteinProbable alpha-amylase 2
- GeneAMY2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids413 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
Probable alpha-amylase that does not seem to be required for breakdown of transitory starch in leaves.
Catalytic activity
Cofactor
Features
Showing features for binding site, active site, site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 74-75 | substrate | ||||
Sequence: YL | ||||||
Binding site | 191-196 | substrate | ||||
Sequence: RFDFAR | ||||||
Active site | 193 | Nucleophile | ||||
Sequence: D | ||||||
Active site | 218 | Proton donor | ||||
Sequence: E | ||||||
Binding site | 220 | substrate | ||||
Sequence: W | ||||||
Binding site | 222 | substrate | ||||
Sequence: S | ||||||
Binding site | 239 | substrate | ||||
Sequence: Q | ||||||
Binding site | 246 | substrate | ||||
Sequence: D | ||||||
Binding site | 280 | substrate | ||||
Sequence: K | ||||||
Binding site | 286-288 | substrate | ||||
Sequence: GWW | ||||||
Binding site | 299 | substrate | ||||
Sequence: H | ||||||
Site | 300 | Transition state stabilizer | ||||
Sequence: D | ||||||
Binding site | 305 | substrate | ||||
Sequence: Q | ||||||
Binding site | 386 | substrate | ||||
Sequence: K | ||||||
Binding site | 411 | substrate | ||||
Sequence: W |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | extracellular region | |
Molecular Function | alpha-amylase activity | |
Molecular Function | calcium ion binding | |
Biological Process | carbohydrate metabolic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameProbable alpha-amylase 2
- EC number
- Short namesAtAMY2
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ8LFG1
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
No visible phenotype under normal growth conditions.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 37 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000418862 | 1-413 | Probable alpha-amylase 2 | |||
Sequence: MGYYNNVFDECNDQTDIGRVIRDGREVILQAYNWESHKYDWWRNLDGKVPDIAKSGFTSAWLPPPSQSLAPEGYLPQDLYSLNSAYGSEHLLKSLLRKMKQYKVRAMADIVINHRVGTTRGHGGMYNRYDGISLPWDEHAVTSCTGGLGNRSTGDNFNGVPNVDHTQHFVRKDIIGWLRWLRNTVGFQDFRFDFARGYSANYVKEYIGAAKPLFSVGECWDSCNYNGHGLDYNQDSHRQRIISWIDATGQISAAFDFTTKGILQEAVKGQYWRLCDAQGKPPGVMGWWPSRAVTFLDNHDTGSTQAHWPFPSHHVMEGYAYILTHPGIPCVFYDHFYDWGSSIHDQIVKLIDIRRRQDIHSRSTVRVLKAESNLYAAIVGEKICMKLGDGSWCPSGRDWTLATSGHRYAVWHK |
Proteomic databases
Expression
Tissue specificity
Expressed in developing siliques.
Induction
Circadian-regulated, with a peak in expression at the beginning of the light period.
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Length413
- Mass (Da)47,170
- Last updated2002-10-01 v1
- Checksum6825F1BBB4352226
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC009978 EMBL· GenBank· DDBJ | AAF17626.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
CP002684 EMBL· GenBank· DDBJ | AEE35800.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002684 EMBL· GenBank· DDBJ | ANM61100.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK221564 EMBL· GenBank· DDBJ | BAD94995.1 EMBL· GenBank· DDBJ | mRNA | ||
BT025560 EMBL· GenBank· DDBJ | ABF58978.1 EMBL· GenBank· DDBJ | mRNA | ||
AY084871 EMBL· GenBank· DDBJ | AAM61434.1 EMBL· GenBank· DDBJ | mRNA |