Q8LFD3 · ATB23_ARATH
- ProteinHomeobox-leucine zipper protein ATHB-23
- GeneATHB-23
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids255 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
Probable transcription factor.
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 68-127 | Homeobox | ||||
Sequence: MGEKKRRLNMEQLKALEKDFELGNKLESDRKLELARALGLQPRQIAIWFQNRRARSKTKQ |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription factor activity | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | transcription cis-regulatory region binding | |
Biological Process | lateral root development | |
Biological Process | lateral root formation | |
Biological Process | response to gibberellin | |
Biological Process | root system development |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameHomeobox-leucine zipper protein ATHB-23
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ8LFD3
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000257800 | 1-255 | Homeobox-leucine zipper protein ATHB-23 | |||
Sequence: MSCNNNGLAFFPENFSLQNHHQEEEDHPQLLQDFHGFLGKRSPMNNVQGFCNLDMNGDEEYSDDGSKMGEKKRRLNMEQLKALEKDFELGNKLESDRKLELARALGLQPRQIAIWFQNRRARSKTKQLEKDYDMLKRQFESLRDENEVLQTQNQKLQAQVMALKSREPIESINLNKETEGSCSDRSENISGDIRPPEIDSQFALGHPPTTTTMQFFQNSSSEQRMVKEENSISNMFCGIDDQSGFWPWLDQQQYN |
Proteomic databases
Expression
Tissue specificity
Expressed in young leaves, in the adaxial domain of leaf primordia and the rib meristem. Expressed in the styles of flowers and siliques.
Induction
By gibberellic acid (GA3).
Gene expression databases
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 128-163 | Leucine-zipper | ||||
Sequence: LEKDYDMLKRQFESLRDENEVLQTQNQKLQAQVMAL |
Sequence similarities
Belongs to the HD-ZIP homeobox family. Class I subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length255
- Mass (Da)29,663
- Last updated2002-10-01 v1
- Checksum4A131B988E29D75C
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC005508 EMBL· GenBank· DDBJ | AAD14502.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
CP002684 EMBL· GenBank· DDBJ | AEE30764.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BT009727 EMBL· GenBank· DDBJ | AAP88361.1 EMBL· GenBank· DDBJ | mRNA | ||
AK228056 EMBL· GenBank· DDBJ | BAF00017.1 EMBL· GenBank· DDBJ | mRNA | ||
AY084913 EMBL· GenBank· DDBJ | AAM61475.1 EMBL· GenBank· DDBJ | mRNA |