Q8LD46 · R23A1_ARATH
- ProteinLarge ribosomal subunit protein uL23z
- GeneRPL23AA
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids154 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
Binds to a specific region on the 26S rRNA.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosolic large ribosomal subunit | |
Cellular Component | cytosolic ribosome | |
Cellular Component | Golgi apparatus | |
Cellular Component | nucleolus | |
Cellular Component | plant-type cell wall | |
Cellular Component | plasmodesma | |
Molecular Function | mRNA binding | |
Molecular Function | rRNA binding | |
Molecular Function | structural constituent of ribosome | |
Biological Process | response to cold | |
Biological Process | response to high light intensity | |
Biological Process | response to oxidative stress | |
Biological Process | translation |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameLarge ribosomal subunit protein uL23z
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ8LD46
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000129473 | 1-154 | Large ribosomal subunit protein uL23z | |||
Sequence: MSPAKVDTTKKADPKAKALKAAKAVKSGQAFKKKDKKIRTKVTFHRPKTLTKPRTGKYPKISATPRNKLDHYQILKYPLTTESAMKKIEDNNTLVFIVDIRADKKKIKDAVKKMYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANKIGII |
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Sequence
- Sequence statusComplete
- Length154
- Mass (Da)17,441
- Last updated2005-08-30 v2
- Checksum73B914DAABFB34A9
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 35 | in Ref. 5; AAM64290 | ||||
Sequence: D → G | ||||||
Sequence conflict | 136 | in Ref. 1; AAB87692 | ||||
Sequence: V → M |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF034694 EMBL· GenBank· DDBJ | AAB87692.1 EMBL· GenBank· DDBJ | mRNA | ||
AC004218 EMBL· GenBank· DDBJ | AAC27837.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002685 EMBL· GenBank· DDBJ | AEC09680.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002685 EMBL· GenBank· DDBJ | AEC09681.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF325056 EMBL· GenBank· DDBJ | AAG40408.1 EMBL· GenBank· DDBJ | mRNA | ||
AY037235 EMBL· GenBank· DDBJ | AAK59835.1 EMBL· GenBank· DDBJ | mRNA | ||
AY039850 EMBL· GenBank· DDBJ | AAK63954.1 EMBL· GenBank· DDBJ | mRNA | ||
AY060540 EMBL· GenBank· DDBJ | AAL31171.1 EMBL· GenBank· DDBJ | mRNA | ||
AY086212 EMBL· GenBank· DDBJ | AAM64290.1 EMBL· GenBank· DDBJ | mRNA |