Q8K0N0 · Q8K0N0_MOUSE
- ProteinDystrobrevin
- GeneDtnb
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids602 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score2/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Molecular Function | zinc ion binding |
Keywords
- Ligand
Names & Taxonomy
Protein names
- Recommended nameDystrobrevin
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ8K0N0
Proteomes
Organism-specific databases
Subcellular Location
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain, coiled coil, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 238-294 | ZZ-type | ||||
Sequence: FHPVECSYCHCESMMGFRYRCQQCHNYQLCQNCFWRGHASGAHSNQHQMKEHSSWKS | ||||||
Coiled coil | 429-509 | |||||
Sequence: NFDANKQQRQLIAELENKNREILQEIQRLRLEHEQASQPTPEKAQQNPMLLAELRLLRQRKDELEQRMSALQESRRELMVQ | ||||||
Region | 520-562 | Disordered | ||||
Sequence: QATGSPHTSPTHGGGRPMPMPVRSTSAGSTPTHGPQDSLSGVG | ||||||
Compositional bias | 542-556 | Polar residues | ||||
Sequence: RSTSAGSTPTHGPQD |
Sequence similarities
Belongs to the dystrophin family. Dystrobrevin subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length602
- Mass (Da)68,181
- Last updated2002-10-01 v1
- Checksum414F86E3300B045C
Computationally mapped potential isoform sequences
There are 15 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
O70585 | DTNB_MOUSE | Dtnb | 659 | ||
Q8C8Z9 | Q8C8Z9_MOUSE | Dtnb | 608 | ||
G3UZJ3 | G3UZJ3_MOUSE | Dtnb | 559 | ||
G3UYD1 | G3UYD1_MOUSE | Dtnb | 107 | ||
G3UYK9 | G3UYK9_MOUSE | Dtnb | 490 | ||
G3UYM7 | G3UYM7_MOUSE | Dtnb | 626 | ||
G3UYN2 | G3UYN2_MOUSE | Dtnb | 138 | ||
G3UZ85 | G3UZ85_MOUSE | Dtnb | 63 | ||
G3UZ87 | G3UZ87_MOUSE | Dtnb | 609 | ||
G3UXH9 | G3UXH9_MOUSE | Dtnb | 149 | ||
G3UXI3 | G3UXI3_MOUSE | Dtnb | 265 | ||
G3UXK0 | G3UXK0_MOUSE | Dtnb | 566 | ||
G3UXP7 | G3UXP7_MOUSE | Dtnb | 90 | ||
G3UY34 | G3UY34_MOUSE | Dtnb | 596 | ||
G3UX96 | G3UX96_MOUSE | Dtnb | 123 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 542-556 | Polar residues | ||||
Sequence: RSTSAGSTPTHGPQD |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BC030924 EMBL· GenBank· DDBJ | AAH30924.1 EMBL· GenBank· DDBJ | mRNA |