Q8IJK4 · MNMA_PLAF7
- ProteinPutative tRNA-specific 2-thiouridylase
- GeneMNMA
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids1084 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
function
Catalyzes the 2-thiolation of uridine at the wobble position (U34) of tRNA, leading to the formation of s2U34 (By similarity).
Required for apicoplast maintenance (PubMed:37166116).
Required for apicoplast maintenance (PubMed:37166116).
Catalytic activity
- AH2 + ATP + S-sulfanyl-L-cysteinyl-[protein] + uridine34 in tRNA = 2-thiouridine34 in tRNA + A + AMP + diphosphate + H+ + L-cysteinyl-[protein]
CHEBI:17499 + CHEBI:30616 + RHEA-COMP:11726 + RHEA-COMP:11727 CHEBI:65315 Position: 34= RHEA-COMP:11728 CHEBI:87170 Position: 34+ CHEBI:13193 + CHEBI:456215 + CHEBI:33019 + CHEBI:15378 + RHEA-COMP:10131
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 538 | Nucleophile | ||||
Sequence: C | ||||||
Active site | 715 | Cysteine persulfide intermediate | ||||
Sequence: C |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | apicoplast | |
Cellular Component | membrane | |
Molecular Function | ATP binding | |
Molecular Function | tRNA (5-methylaminomethyl-2-thiouridylate)(34)-methyltransferase activity | |
Molecular Function | tRNA binding | |
Biological Process | tRNA processing |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namePutative tRNA-specific 2-thiouridylase
- EC number
- Short namesPfMnmA
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Sar > Alveolata > Apicomplexa > Aconoidasida > Haemosporida > Plasmodiidae > Plasmodium > Plasmodium (Laverania)
Accessions
- Primary accessionQ8IJK4
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 1-21 | Helical | ||||
Sequence: MLIFFFFFFFFKYIYNIFILT | ||||||
Transmembrane | 32-52 | Helical | ||||
Sequence: FIISFIFSTLMFFYFCTFYVI | ||||||
Transmembrane | 309-329 | Helical | ||||
Sequence: IITIDAYSNNLILYCFLYLIL |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000459587 | 1-1084 | Putative tRNA-specific 2-thiouridylase | |||
Sequence: MLIFFFFFFFFKYIYNIFILTCFYITLSSYYFIISFIFSTLMFFYFCTFYVISLFFLYISSFCKSIKVTQLYDKKIKIKSFINNYLVSCRKKKYIYNNVDDKSNIGTFNLYHNIRDNNNNNNNNDNNNNLKKRDDVLFPLCNKNIINDVQKIYDEVNNIKDKEQKINYLMEQCSSLCKENYFPPILNLNKAYRNKRIDEFNKGNKNFYINEVGKNIWYKYVNRCDEILFMAIDIQIDEDEQRNNSIKDVHDVHDDNIKTCTLIKDDKHFEKYKDIHNDNILKNILPLDKKIDSIKNMLNHKYMKKKKCIITIDAYSNNLILYCFLYLILKHINKMYLYSFMNIQIKEITAKLKELFDLHFNVHHIIDYIHEYIYNFLMSYHIKRKKNKSKNMKEKDIKNVFANNIIISDEENKHISKESSDMYKKKTTITTTTTTKKKKNTMKLFTYPRIAHMLSGGVDSLMALHLLERKKFYVDNYFFNFTNADCSKNDIKYVKDICKNNKRNLFIININDEYFDEVLVPMLFFYADGKVPNPDIMCNQKIKYNFFLKVIKSIYKQKWNYRTKSKLCNYDFISTGHYAMIRTNDKNNPNNIFNNNLFIKKKKKKIKNIKNKKNIKNKNNIKNKNNNNNIYTYNIYNLHNDNIKTNYKKNNKYFYKLLVSNDKKKDQTFFLSSFNHIQLSKFIFPLSLYTKKDVKKYMNENNINNYNHKETKGLCLFGNIDMQTLLHKYFVNTEKDDIKNKQNEDNIFKENNILNLNNNFNQNEKKKKKEKKLLVDITTTSSHLKKFRETFIPKMNLHYKNYLINLDDQTILDINSDIHLYAIGQHKNVTNYLHNLYNKKMININGYKKKHVKNVISSFQWIVVYKKIKRDMSTNLIHNFIYLTKNYDQDLFTHIRTKCKLHNIKWIEGKLPACIKKQFKKYNKINKKKKKINNNNNKYKTNETFHVYNNIQESGKKKKKKKVKNIPHDEKTIFVKIRNSEQIKKAKIKFSLSNNTAYLKVKQKDTGFSPGQIITLYFPFIIKKNNKVTYITNLNKYNNLINTNKNTIYYHCLGSATISNQFLDYNLYQHIKNIHQINDLNMSK | ||||||
Disulfide bond | 538↔715 | Alternate | ||||
Sequence: CNQKIKYNFFLKVIKSIYKQKWNYRTKSKLCNYDFISTGHYAMIRTNDKNNPNNIFNNNLFIKKKKKKIKNIKNKKNIKNKNNIKNKNNNNNIYTYNIYNLHNDNIKTNYKKNNKYFYKLLVSNDKKKDQTFFLSSFNHIQLSKFIFPLSLYTKKDVKKYMNENNINNYNHKETKGLC |
Keywords
- PTM
Proteomic databases
Interaction
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Length1,084
- Mass (Da)130,518
- Last updated2009-09-22 v2
- ChecksumDC871042759669AF
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
LN999944 EMBL· GenBank· DDBJ | CZT98453.1 EMBL· GenBank· DDBJ | Genomic DNA |