Q8I7X1 · AGH_PORSC
- ProteinAndrogenic gland hormone
- GeneAGH
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids145 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Controls sex differentiation and the formation of male appendages, spermatogenesis, pigmentation, and male specific behavior.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Molecular Function | hormone activity | |
Biological Process | cell differentiation | |
Biological Process | sex differentiation | |
Biological Process | spermatogenesis |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameAndrogenic gland hormone
- Alternative names
- Cleaved into 2 chains
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Crustacea > Multicrustacea > Malacostraca > Eumalacostraca > Peracarida > Isopoda > Oniscidea > Crinocheta > Porcellionidae > Porcellio
Accessions
- Primary accessionQ8I7X1
- Secondary accessions
Subcellular Location
PTM/Processing
Features
Showing features for signal, peptide, disulfide bond, propeptide, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-21 | |||||
Sequence: MKGLLFIVSLLCLTLHQRVWA | ||||||
Peptide | PRO_0000020650 | 22-65 | Androgenic gland hormone B chain | |||
Sequence: YQVIGMKSDVICADIRFTVHCICNELGLFPTSRLSKPCPWPNRG | ||||||
Disulfide bond | 33↔122 | Or C-33 with C-124 | ||||
Sequence: CADIRFTVHCICNELGLFPTSRLSKPCPWPNRGRRSADDEDYLFEEDEDDEFFHPRALSPPAAKSGDERLEDEVSFHSRSKRDIAFHEEC | ||||||
Disulfide bond | 42↔59 | Or C-44 with C-59 | ||||
Sequence: CICNELGLFPTSRLSKPC | ||||||
Disulfide bond | 44↔140 | Or C-42 with C-141 | ||||
Sequence: CNELGLFPTSRLSKPCPWPNRGRRSADDEDYLFEEDEDDEFFHPRALSPPAAKSGDERLEDEVSFHSRSKRDIAFHEECCNIRTEHKCNKTTVELYC | ||||||
Propeptide | PRO_0000020651 | 68-112 | C peptide | |||
Sequence: SADDEDYLFEEDEDDEFFHPRALSPPAAKSGDERLEDEVSFHSRS | ||||||
Peptide | PRO_0000020652 | 115-145 | Androgenic gland hormone A chain | |||
Sequence: DIAFHEECCNIRTEHKCNKTTVELYCRRYTR | ||||||
Disulfide bond | 123↔131 | Or C-123 with C-132 | ||||
Sequence: CNIRTEHKC | ||||||
Glycosylation | 132 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
PTM databases
Expression
Tissue specificity
Androgenic gland.
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length145
- Mass (Da)16,973
- Last updated2003-03-01 v1
- Checksum4E5135942DE86694
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 97 | in Ref. 2; BAC57012 | ||||
Sequence: S → N |
Mass Spectrometry
Androgenic gland hormone B chain
Molecular mass is 4,966.8 Da. Determined by MALDI.Androgenic gland hormone A chain
Molecular mass is 5,443 Da. Determined by MALDI.Keywords
- Technical term