Q8HXG8 · BCDO2_MACFA
- ProteinCarotenoid-cleaving dioxygenase, mitochondrial
- GeneBCO2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids556 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Broad specificity mitochondrial dioxygenase that mediates the asymmetric oxidative cleavage of carotenoids. Cleaves carotenes (pure hydrocarbon carotenoids) such as all-trans-beta-carotene and lycopene as well as xanthophylls (oxygenated carotenoids) such as zeaxanthin, lutein and beta-cryptoxanthin at both the 9,10 and the 9',10' carbon-carbon double bond. Through its function in carotenoids metabolism regulates oxidative stress and the production of important signaling molecules.
Catalytic activity
- all-trans-beta-carotene + O2 = all-trans-10'-apo-beta-carotenal + beta-iononeThis reaction proceeds in the forward direction.
- 5-cis-lycopene + O2 = (3E,5E)-6,10-dimethylundeca-3,5,9-trien-2-one + 5-cis-10'-apo-lycopenalThis reaction proceeds in the forward direction.
- 13-cis-lycopene + O2 = (3E,5E)-6,10-dimethylundeca-3,5,9-trien-2-one + 13-cis-10'-apo-lycopenalThis reaction proceeds in the forward direction.
- lutein + O2 = (3R)-3-hydroxy-10'-apo-beta-carotenal + (3R,6R)-hydroxy-alpha-iononeThis reaction proceeds in the forward direction.
- lutein + O2 = (3R)-hydroxy-beta-ionone + (3R,6R)-3-hydroxy-10'-apo-alpha-carotenalThis reaction proceeds in the forward direction.
- all-trans-zeaxanthin + 2 O2 = 2 (3R)-hydroxy-beta-ionone + 4,9-dimethyldodeca-2,4,6,8,10-pentaenedialThis reaction proceeds in the forward direction.
- all-trans-zeaxanthin + O2 = (3R)-3-hydroxy-10'-apo-beta-carotenal + (3R)-hydroxy-beta-iononeThis reaction proceeds in the forward direction.
- beta-cryptoxanthin + O2 = (3R)-hydroxy-beta-ionone + all-trans-10'-apo-beta-carotenalThis reaction proceeds in the forward direction.
- all-trans-10'-apo-beta-carotenal + O2 = 4,9-dimethyldodeca-2,4,6,8,10-pentaenedial + beta-iononeThis reaction proceeds in the forward direction.
- (3R)-3-hydroxy-10'-apo-beta-carotenal + O2 = (3R)-hydroxy-beta-ionone + 4,9-dimethyldodeca-2,4,6,8,10-pentaenedialThis reaction proceeds in the forward direction.
- (3R,6R)-3-hydroxy-10'-apo-alpha-carotenal + O2 = (3R,6R)-hydroxy-alpha-ionone + 4,9-dimethyldodeca-2,4,6,8,10-pentaenedialThis reaction proceeds in the forward direction.
Cofactor
Note: Binds 1 Fe2+ ion per subunit.
Features
Showing features for binding site.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrion | |
Molecular Function | 9,10 (9', 10')-carotenoid-cleaving dioxygenase activity | |
Molecular Function | beta,beta-carotene-9',10'-cleaving oxygenase activity | |
Molecular Function | metal ion binding | |
Molecular Function | oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen | |
Biological Process | carotene catabolic process | |
Biological Process | carotene metabolic process | |
Biological Process | lutein catabolic process | |
Biological Process | lycopene catabolic process | |
Biological Process | xanthophyll catabolic process | |
Biological Process | zeaxanthin catabolic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameCarotenoid-cleaving dioxygenase, mitochondrial
- EC number
- Alternative names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Cercopithecidae > Cercopithecinae > Macaca
Accessions
- Primary accessionQ8HXG8
Proteomes
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000143938 | 1-556 | Carotenoid-cleaving dioxygenase, mitochondrial | |||
Sequence: MVHPLPVFKRYTGNTHQKKAIFGQCRGLPCVAPLLTTVEEAPRGISARVWGHFPKWLNGSLLRIGPGKFEFGKDKYNHWFDGMALLHQFRMAKGTVTYRSKFLQSDTYKANSAKNRIVMSEFGTLATPDPCKNVFERFMSRFELPGKAAAMTDNTNVNYVRYKGDYYLCTETNFMNKVDIETLEKTEKVDWSKFIAVNGATAHPHYDPDGTAYNMGNSFGPFGFSYKVIRVPPEKVDLEETTHGAQVICSIAPTEKGKPSYYHSFGMTRNYIIFIEQPLKMNLWKIATSKIRGKAFSDGISWEPQCNTRFHVVDKHTGQLLPGRYYSKPFVAFHHINAFEDQGCVIIDLCCQDNGRILEVYQLQNLRKAGEELDQVYNSAGRSFPRRFVLPLNVSLNAPEGDNLSPLSYTSASAVKQADGTIWCSHENLHQEDLEKEGGIEFPQIYYGQFSGKKYRFFYGCGFRHLVGDSLIKVDVVNKTLKVWREDGFYPSEPVFVPVPGTNEEDGGVILSVVITPNQNESNFLLVLDAKNFEELGRAEVPVQMPYGFHGTFIPI |
Interaction
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Length556
- Mass (Da)62,966
- Last updated2003-10-10 v2
- Checksum2A7BD970DE2AE6A6
Sequence caution
Keywords
- Technical term