Q8H5D4 · PLP3_ORYSJ
- ProteinPatatin-like protein 3
- GenePLP3
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids413 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Possesses non-specific lipolytic acyl hydrolase (LAH) activity. Hydrolyzes phospholipids as well as galactolipids. May play a role in disease resistance (By similarity).
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 100 | Nucleophile | ||||
Sequence: S |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | hydrolase activity | |
Biological Process | defense response | |
Biological Process | lipid catabolic process |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namePatatin-like protein 3
- EC number
- Short namesOsPLP3
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ8H5D4
- Secondary accessions
Proteomes
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000425824 | 1-413 | Patatin-like protein 3 | |||
Sequence: MEAGQDDAADRLTYEIFSILESKFLFGYGGGGGGETKSLQCAPPVSRGNRVCVLSVDGGARPEDGLLAAAALVRLEAAVQRRAGSKAARLADFFDVAAGSGAGGVLAAMLFARGPCGRPMYSADDALGFLLRRVRRRGWSSRAGGLLRRPAGAFHKVFGELTLRDTVRPVLVPCYDLATRAPFLFSRADAAQSPAYDFRLRDACAATCAPSGGGAAVEASSVDGVTRITAVGSGVALGNPTAAAITHVLNNRREFPAAAGVDNLLVISIGTGEAAGSSSRHRARTPVIARIAAEGASDMVDQAVAMAFGQHRTSNYVRIQGMGVARRRGGGVACGGETAEKAVWVAEAMLQQRNVEAVMFQGRRLAGETNAEKVERFARELIKEHGRRKQHVPPAASGGGGGGLDCHVSKKQP |
Proteomic databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, motif, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 54-245 | PNPLA | ||||
Sequence: LSVDGGARPEDGLLAAAALVRLEAAVQRRAGSKAARLADFFDVAAGSGAGGVLAAMLFARGPCGRPMYSADDALGFLLRRVRRRGWSSRAGGLLRRPAGAFHKVFGELTLRDTVRPVLVPCYDLATRAPFLFSRADAAQSPAYDFRLRDACAATCAPSGGGAAVEASSVDGVTRITAVGSGVALGNPTAAAI | ||||||
Motif | 58-61 | GGXR | ||||
Sequence: GGAR | ||||||
Region | 384-413 | Disordered | ||||
Sequence: EHGRRKQHVPPAASGGGGGGLDCHVSKKQP |
Domain
The nitrogen atoms of the two glycine residues in the GGXR motif define the oxyanion hole, and stabilize the oxyanion that forms during the nucleophilic attack by the catalytic serine during substrate cleavage.
Sequence similarities
Belongs to the patatin family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length413
- Mass (Da)43,029
- Last updated2003-03-01 v1
- Checksum493083E35F260D7E
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0N7KMX5 | A0A0N7KMX5_ORYSJ | Os07g0144500 | 416 |
Keywords
- Technical term