Q8GZP6 · ANAO2_ANAOC
- Protein11S globulin seed storage protein Ana o 2.0101
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids457 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Seed storage protein.
Biotechnology
Can be used as part of the diagnostics for predicting the risk for positive double-blind, placebo-controlled food challenge test (DBPCFC) in cashew-allergic children. The risk increases with higher specific IgE levels to this protein.
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 34 | Critical for epitope recognition by the mouse monoclonal antibody (mAb) 2B5 | ||||
Sequence: E |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | IgE binding | |
Molecular Function | IgG binding | |
Molecular Function | nutrient reservoir activity | |
Biological Process | protein homotrimerization | |
Biological Process | seed maturation |
Keywords
- Molecular function
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended name11S globulin seed storage protein Ana o 2.0101
- Alternative names
- Cleaved into 2 chains
- Allergen nameAna o 2.0101
Organism names
- Organism
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Sapindales > Anacardiaceae > Anacardium
Accessions
- Primary accessionQ8GZP6
Phenotypes & Variants
Allergenic properties
Causes an allergic reaction in human (PubMed:14555856, PubMed:18558706, PubMed:20362336, PubMed:24926808, PubMed:25766831, PubMed:26769082, PubMed:27129138, PubMed:27513566).
Binds to IgE of patients allergic to cashew nuts (PubMed:14555856, PubMed:18558706, PubMed:20362336, PubMed:24926808, PubMed:25766831, PubMed:26769082, PubMed:27513566).
Recombinant protein binds to IgE in 62% of the 21 patients tested (PubMed:14555856).
Reduced IgE-binding following 50 mM sodium sulfite treatment at 100 degrees Celsius or by 5 mM dithiothreitol (DTT) (PubMed:24926808).
IgE-binding is reduced by 35% with 5 mM sodium oleate treatment at 70 degrees Celsius for 60 min only if followed by an additional overnight incubation at 37 degrees Celsius (PubMed:25766831).
Allergenicity is removed from the cashew apple juice concentrate by 5 kDa filtration (PubMed:18558706).
Retains immunoreactivity for mouse monoclonal antibodies (mAbs) 4C3 and 4H9 after a variety of processing treatments including autoclaving, blanching, microwave heating, dry roasting, gamma-irradiation and pH (PubMed:18795784).
Significantly reduced immunoreactivity for mouse mAb 4C3 by 2.5 mM sodium dodecyl sulfate (SDS) or 2% v/v reducing agent beta-mercaptoethanol (beta-ME) with heat (100 degrees Celsius for 10 min) treatments (PubMed:21138244).
Exposure to extreme pH (1 or 13) and extreme heat treatments (autoclaving for 30 min or roasting at 200 degrees Celsius for 15 min) results in almost complete loss of binding to mouse mAb 4C3 (PubMed:18795784).
Mouse mAb 2B5 recognizes a conformational epitope on the acidic chain of this protein, the recognition of which requires the association of the basic chain, but is independent of their post-translational cleavage. The antibody competes with patient IgE for binding to the epitope. The epitope is destroyed by physical (boiling) and chemical (0.5 M beta-ME, 10% SDS and 6 M urea) denturation (PubMed:20362336).
Cashew allergic patients elicit responses to this protein by CD4+ T cells with T-helper 2 (Th2) and Th2/T-helper 17 (Th17) phenotypes (PubMed:27129138).
Binds to IgE of patients allergic to cashew nuts (PubMed:14555856, PubMed:18558706, PubMed:20362336, PubMed:24926808, PubMed:25766831, PubMed:26769082, PubMed:27513566).
Recombinant protein binds to IgE in 62% of the 21 patients tested (PubMed:14555856).
Reduced IgE-binding following 50 mM sodium sulfite treatment at 100 degrees Celsius or by 5 mM dithiothreitol (DTT) (PubMed:24926808).
IgE-binding is reduced by 35% with 5 mM sodium oleate treatment at 70 degrees Celsius for 60 min only if followed by an additional overnight incubation at 37 degrees Celsius (PubMed:25766831).
Allergenicity is removed from the cashew apple juice concentrate by 5 kDa filtration (PubMed:18558706).
Retains immunoreactivity for mouse monoclonal antibodies (mAbs) 4C3 and 4H9 after a variety of processing treatments including autoclaving, blanching, microwave heating, dry roasting, gamma-irradiation and pH (PubMed:18795784).
Significantly reduced immunoreactivity for mouse mAb 4C3 by 2.5 mM sodium dodecyl sulfate (SDS) or 2% v/v reducing agent beta-mercaptoethanol (beta-ME) with heat (100 degrees Celsius for 10 min) treatments (PubMed:21138244).
Exposure to extreme pH (1 or 13) and extreme heat treatments (autoclaving for 30 min or roasting at 200 degrees Celsius for 15 min) results in almost complete loss of binding to mouse mAb 4C3 (PubMed:18795784).
Mouse mAb 2B5 recognizes a conformational epitope on the acidic chain of this protein, the recognition of which requires the association of the basic chain, but is independent of their post-translational cleavage. The antibody competes with patient IgE for binding to the epitope. The epitope is destroyed by physical (boiling) and chemical (0.5 M beta-ME, 10% SDS and 6 M urea) denturation (PubMed:20362336).
Cashew allergic patients elicit responses to this protein by CD4+ T cells with T-helper 2 (Th2) and Th2/T-helper 17 (Th17) phenotypes (PubMed:27129138).
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 34 | Significantly reduced binding to mouse monoclonal antibody (mAb) 2B5. | ||||
Sequence: E → A | ||||||
Mutagenesis | 36 | Loss of binding to mouse monoclonal antibody (mAb) 2B5. | ||||
Sequence: D → A | ||||||
Mutagenesis | 38 | Loss of binding to mouse monoclonal antibody (mAb) 2B5. | ||||
Sequence: R → A | ||||||
Mutagenesis | 39 | Significantly reduced binding to mouse monoclonal antibody (mAb) 2B5. | ||||
Sequence: V → A | ||||||
Mutagenesis | 40 | Significantly reduced binding to mouse monoclonal antibody (mAb) 2B5. | ||||
Sequence: E → A | ||||||
Mutagenesis | 42 | Significantly reduced binding to mouse monoclonal antibody (mAb) 2B5. | ||||
Sequence: E → A | ||||||
Mutagenesis | 50 | Loss of binding to mouse monoclonal antibody (mAb) 2B5. | ||||
Sequence: D → A | ||||||
Mutagenesis | 52 | No effect in binding to mouse monoclonal antibody (mAb) 2B5. | ||||
Sequence: N → A | ||||||
Mutagenesis | 53 | Significantly reduced binding to mouse monoclonal antibody (mAb) 2B5. | ||||
Sequence: H → A | ||||||
Mutagenesis | 54 | No effect in binding to mouse monoclonal antibody (mAb) 2B5. | ||||
Sequence: E → A | ||||||
Mutagenesis | 57 | Significantly reduced binding to mouse monoclonal antibody (mAb) 2B5. | ||||
Sequence: R → A |
Keywords
- Disease
Protein family/group databases
PTM/Processing
Features
Showing features for signal, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-14 | |||||
Sequence: LSVCFLILFHGCLA | ||||||
Chain | PRO_0000448659 | 15-271 | 11S globulin seed storage protein Ana o 2.0101 acidic chain | |||
Sequence: SRQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETYQAPQQGRQQGQSGRFQDRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPKDVFQQQQQHQSRGRNLFSGFDTELLAEAFQVDERLIKQLKSEDNRGGIVKVKDDELRVIRPSRSQSERGSESEEESEDEKRRWGQRDN | ||||||
Disulfide bond | 25↔58 | |||||
Sequence: CQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFRC | ||||||
Disulfide bond | 101↔278 | Interchain (between acidic and basic chains) | ||||
Sequence: CPETYQAPQQGRQQGQSGRFQDRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPKDVFQQQQQHQSRGRNLFSGFDTELLAEAFQVDERLIKQLKSEDNRGGIVKVKDDELRVIRPSRSQSERGSESEEESEDEKRRWGQRDNGIEETIC | ||||||
Chain | PRO_0000448660 | 272-457 | 11S globulin seed storage protein Ana o 2.0101 basic chain | |||
Sequence: GIEETICTMRLKENINDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEVLANAFQISREDARKIKFNNQQTTLTSGESSHHMRDDA |
Post-translational modification
Proteolytically processed from a single precursor to produce an acidic and a basic chain that are linked by a disulfide bond (PubMed:14555856, PubMed:20362336, PubMed:24926808, PubMed:26769082).
Not glycosylated (PubMed:26769082).
Not glycosylated (PubMed:26769082).
Keywords
- PTM
Expression
Tissue specificity
Expressed in seed (at protein level) (PubMed:14555856, PubMed:18558706, PubMed:18795784, PubMed:20362336, PubMed:21138244, PubMed:24926808, PubMed:25766831, PubMed:26769082, PubMed:27513566, PubMed:28959544).
Expressed in the juice of the cashew apple (at protein level) (PubMed:18558706).
Expressed in the juice of the cashew apple (at protein level) (PubMed:18558706).
Developmental stage
Structure
Family & Domains
Features
Showing features for region, domain, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 15-29 | IgE-binding | ||||
Sequence: SRQEWQQQDECQIDR | ||||||
Region | 29-37 | Conformational epitope; mouse monoclonal antibody (mAb) 2B5-binding | ||||
Sequence: RLDALEPDN | ||||||
Domain | 30-220 | Cupin type-1 1 | ||||
Sequence: LDALEPDNRVEYEAGTVEAWDPNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETYQAPQQGRQQGQSGRFQDRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPKDVFQQQQQHQSRGRNLFSGFDTELLAEAFQVDERLIK | ||||||
Region | 31-48 | Conformational epitope; mouse monoclonal antibody (mAb) 2B5-binding | ||||
Sequence: DALEPDNRVEYEAGTVEA | ||||||
Region | 32-45 | Binds goat polyclonal antibodies (pAbs) | ||||
Sequence: ALEPDNRVEYEAGT | ||||||
Region | 34-57 | Mouse monoclonal antibody (mAb) 2B5-binding | ||||
Sequence: EPDNRVEYEAGTVEAWDPNHEQFR | ||||||
Region | 41-55 | Mouse monoclonal antibody (mAb) 4H9-binding | ||||
Sequence: YEAGTVEAWDPNHEQ | ||||||
Region | 55-86 | Binds goat polyclonal antibodies (pAbs) | ||||
Sequence: QFRCAGVALVRHTIQPNGLLLPQYSNAPQLIY | ||||||
Region | 105-119 | IgE-binding | ||||
Sequence: YQAPQQGRQQGQSGR | ||||||
Region | 215-239 | Binds goat polyclonal antibodies (pAbs) | ||||
Sequence: DERLIKQLKSEDNRGGIVKVKDDEL | ||||||
Region | 233-252 | CD4+ T cell-reactive epitope | ||||
Sequence: KVKDDELRVIRPSRSQSERG | ||||||
Region | 243-270 | Disordered | ||||
Sequence: RPSRSQSERGSESEEESEDEKRRWGQRD | ||||||
Region | 265-289 | Linear epitope; mouse monoclonal antibody (mAb) 1F5-binding | ||||
Sequence: RWGQRDNGIEETICTMRLKENINDP | ||||||
Motif | 271-276 | NGXEET; peptidase recognition motif | ||||
Sequence: NGIEET | ||||||
Domain | 284-433 | Cupin type-1 2 | ||||
Sequence: ENINDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEVLANAFQISREDAR | ||||||
Region | 289-308 | CD4+ T cell-reactive epitope | ||||
Sequence: PARADIYTPEVGRLTTLNSL | ||||||
Region | 297-316 | CD4+ T cell-reactive epitope | ||||
Sequence: PEVGRLTTLNSLNLPILKWL | ||||||
Region | 321-340 | CD4+ T cell-reactive epitope | ||||
Sequence: EKGVLYKNALVLPHWNLNSH | ||||||
Region | 329-348 | CD4+ T cell-reactive epitope | ||||
Sequence: ALVLPHWNLNSHSIIYGCKG | ||||||
Region | 377-396 | CD4+ T cell-reactive epitope | ||||
Sequence: QNFAVVKRAREERFEWISFK | ||||||
Region | 395-416 | Binds goat polyclonal antibodies (pAbs), but buried in the 3D-structure model | ||||
Sequence: FKTNDRAMTSPLAGRTSVLGGM |
Sequence similarities
Belongs to the 11S seed storage protein (globulins) family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusFragment
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length457
- Mass (Da)51,996
- Last updated2003-03-01 v1
- Checksum91413A7A10E6419C
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: L |
Keywords
- Technical term