Q8GX93 · CLCE_ARATH
- ProteinChloride channel protein CLC-e
- GeneCLC-E
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids710 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Voltage-gated thylakoid chloride (Cl) channel/transporter involved in chloride homeostasis after transition from light to dark (PubMed:26904077).
Influences chloroplast ultrastructure and subsequent photosynthetic electron transport (PubMed:26904077).
During photosynthetic response on transition from dark to low light, involved in a sequential mechanism of adaptation; VCCN1 and CLCe first trigger the activation of photoprotection, which is later down-regulated by KEA3 to a low steady state, while adjusting electron transport (PubMed:31201341).
Regulates photosynthesis by a pH-independent mechanism likely involving Cl- homeostasis (PubMed:31201341).
Influences chloroplast ultrastructure and subsequent photosynthetic electron transport (PubMed:26904077).
During photosynthetic response on transition from dark to low light, involved in a sequential mechanism of adaptation; VCCN1 and CLCe first trigger the activation of photoprotection, which is later down-regulated by KEA3 to a low steady state, while adjusting electron transport (PubMed:31201341).
Regulates photosynthesis by a pH-independent mechanism likely involving Cl- homeostasis (PubMed:31201341).
Catalytic activity
- 2 chloride(in) + H+(out) = 2 chloride(out) + H+(in)
2 chloride (in)CHEBI:17996+ H+ (out)CHEBI:15378= 2 chloride (out)CHEBI:17996+ H+ (in)CHEBI:15378
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloride channel complex | |
Cellular Component | chloroplast thylakoid membrane | |
Molecular Function | voltage-gated chloride channel activity | |
Biological Process | chloride transmembrane transport | |
Biological Process | regulation of photosynthesis, light reaction | |
Biological Process | thylakoid membrane organization |
Keywords
- Molecular function
- Biological process
- Ligand
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameChloride channel protein CLC-e
- Short namesAtCLC-e ; AtCLCe
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ8GX93
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 74-94 | Helical; Name=1 | ||||
Sequence: ELAIASACLVGVLTGVSVVLF | ||||||
Transmembrane | 122-142 | Helical; Name=2 | ||||
Sequence: IGSNWLRVILVPTIGGLVVSI | ||||||
Transmembrane | 164-184 | Helical; Name=3 | ||||
Sequence: VKAVLRPFLKTVAACVTLGTG | ||||||
Transmembrane | 193-213 | Helical; Name=4 | ||||
Sequence: SVEIGASIAKGVNSLFNKSPQ | ||||||
Transmembrane | 222-242 | Helical; Name=5 | ||||
Sequence: GSAAGISSGFNAAVAGCFFAV | ||||||
Transmembrane | 261-281 | Helical; Name=6 | ||||
Sequence: TTSMVILSAVTASVVSEIGLG | ||||||
Transmembrane | 296-316 | Helical; Name=7 | ||||
Sequence: PGELPLYLLLGALCGLVSLAL | ||||||
Transmembrane | 340-360 | Helical; Name=8 | ||||
Sequence: VFPVMGGLSVGIIALVYPEVL | ||||||
Transmembrane | 379-399 | Helical; Name=9 | ||||
Sequence: GLSADLLLQLVAVKIAATAWC | ||||||
Transmembrane | 412-432 | Helical; Name=10 | ||||
Sequence: SLFIGGAAGMAYGKFIGLALA | ||||||
Transmembrane | 451-471 | Helical; Name=11 | ||||
Sequence: GLVGMAATLAGVCQVPLTAVL | ||||||
Transmembrane | 472-492 | Helical; Name=12 | ||||
Sequence: LLFELTQDYRIVLPLLGAVGM | ||||||
Transmembrane | 667-687 | Helical; Name=13 | ||||
Sequence: HVAVVSGSIDAPRIHPVGVLD |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
No visible phenotype except reduced nitrate content and disturbed chloride Cl- homeostasis (PubMed:26904077, PubMed:31201341).
Lower photosynthetic performance in dark-adapted plants, associated with abnormal shape and associated parameters of the polyphasic OJIP kinetics of chlorophyll a fluorescence induction (PubMed:26904077, PubMed:31201341).
Mildly altered size and composition of proton motive force (PMF) (PubMed:26904077).
Altered kinetics of state transition and in the macro-organization of photosystem II supercomplexes; phenotypes reversed by potassium chloride (KCl) (PubMed:26904077).
Bow-like arrangement of the thylakoid network and large thylakoid-free stromal region in chloroplast from dark-adapted plants (PubMed:26904077).
Transiently decreased non-photochemical quenching (NPQ) upon transition from dark to low light (PubMed:31201341).
Lower photosynthetic performance and altered NPQ upon transition from dark to low light in clce kea3 and clce vccn1 double mutants, as well as in the clce kea3 vccn1 triple mutant (PubMed:31201341).
Lower photosynthetic performance in dark-adapted plants, associated with abnormal shape and associated parameters of the polyphasic OJIP kinetics of chlorophyll a fluorescence induction (PubMed:26904077, PubMed:31201341).
Mildly altered size and composition of proton motive force (PMF) (PubMed:26904077).
Altered kinetics of state transition and in the macro-organization of photosystem II supercomplexes; phenotypes reversed by potassium chloride (KCl) (PubMed:26904077).
Bow-like arrangement of the thylakoid network and large thylakoid-free stromal region in chloroplast from dark-adapted plants (PubMed:26904077).
Transiently decreased non-photochemical quenching (NPQ) upon transition from dark to low light (PubMed:31201341).
Lower photosynthetic performance and altered NPQ upon transition from dark to low light in clce kea3 and clce vccn1 double mutants, as well as in the clce kea3 vccn1 triple mutant (PubMed:31201341).
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 42 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000094469 | 1-710 | Chloride channel protein CLC-e | |||
Sequence: MAATLPLCAALRSPVSSRRFAPIHKTDVPFQFNVVLSPFFGSVAIGGRIFPRLPAAKQETDQDEVGFDQQPSQELAIASACLVGVLTGVSVVLFNNCVHLLRDFSWDGIPDRGASWLREAPIGSNWLRVILVPTIGGLVVSILNQLRESAGKSTGDSHSSLDRVKAVLRPFLKTVAACVTLGTGNSLGPEGPSVEIGASIAKGVNSLFNKSPQTGFSLLAAGSAAGISSGFNAAVAGCFFAVESVLWPSSSTDSSTSLPNTTSMVILSAVTASVVSEIGLGSEPAFKVPDYDFRSPGELPLYLLLGALCGLVSLALSRCTSSMTSAVDSLNKDAGIPKAVFPVMGGLSVGIIALVYPEVLYWGFQNVDILLEKRPFVKGLSADLLLQLVAVKIAATAWCRASGLVGGYYAPSLFIGGAAGMAYGKFIGLALAQNPDFNLSILEVASPQAYGLVGMAATLAGVCQVPLTAVLLLFELTQDYRIVLPLLGAVGMSSWITSGQSKRQETRETKETRKRKSQEAVQSLTSSDDESSTNNLCEVESSLCLDDSLNQSEELPKSIFVSEAMRTRFATVMMSTSLEEALTRMLIEKQSCALIVDPDNIFLGILTLSDIQEFSKARKEGNNRPKDIFVNDICSRSGGKCKVPWTVTPDMDLLAAQTIMNKHELSHVAVVSGSIDAPRIHPVGVLDRECITLTRRALATRMYLLNSLYL |
Proteomic databases
Expression
Gene expression databases
Interaction
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 500-534 | Disordered | ||||
Sequence: QSKRQETRETKETRKRKSQEAVQSLTSSDDESSTN | ||||||
Compositional bias | 503-518 | Basic and acidic residues | ||||
Sequence: RQETRETKETRKRKSQ | ||||||
Compositional bias | 519-534 | Polar residues | ||||
Sequence: EAVQSLTSSDDESSTN | ||||||
Domain | 565-624 | CBS 1 | ||||
Sequence: MRTRFATVMMSTSLEEALTRMLIEKQSCALIVDPDNIFLGILTLSDIQEFSKARKEGNNR | ||||||
Domain | 640-702 | CBS 2 | ||||
Sequence: KCKVPWTVTPDMDLLAAQTIMNKHELSHVAVVSGSIDAPRIHPVGVLDRECITLTRRALATRM |
Sequence similarities
Belongs to the chloride channel (TC 2.A.49) family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
This entry describes 1 isoforms produced by Alternative splicing. A number of isoforms are produced. According to EST sequences.
Q8GX93-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length710
- Mass (Da)75,556
- Last updated2004-02-02 v2
- Checksum2C7B325F7BF112DE
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
F4JN11 | F4JN11_ARATH | CLC-E | 749 |
Sequence caution
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 297 | in Ref. 1; AAK53390 | ||||
Sequence: Missing | ||||||
Sequence conflict | 453 | in Ref. 1; AAK53390 | ||||
Sequence: Missing | ||||||
Compositional bias | 503-518 | Basic and acidic residues | ||||
Sequence: RQETRETKETRKRKSQ | ||||||
Compositional bias | 519-534 | Polar residues | ||||
Sequence: EAVQSLTSSDDESSTN |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF366367 EMBL· GenBank· DDBJ | AAK53390.1 EMBL· GenBank· DDBJ | mRNA | ||
AL022604 EMBL· GenBank· DDBJ | CAA18726.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
AL117188 EMBL· GenBank· DDBJ | CAB54872.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
AL161587 EMBL· GenBank· DDBJ | CAB80260.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
CP002687 EMBL· GenBank· DDBJ | AEE86510.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK118357 EMBL· GenBank· DDBJ | BAC42971.1 EMBL· GenBank· DDBJ | mRNA | Frameshift |