Q8GWT1 · GAUTE_ARATH
- ProteinProbable galacturonosyltransferase 14
- GeneGAUT14
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids532 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
May be involved in pectin and/or xylans biosynthesis in cell walls (By similarity).
Together with GAUT13, required for pollen tube growth, possibly through the regulation of pectin biosynthesis and repartition in the pollen tube wall (PubMed:23709340).
Together with GAUT13, required for pollen tube growth, possibly through the regulation of pectin biosynthesis and repartition in the pollen tube wall (PubMed:23709340).
Pathway
Glycan metabolism; pectin biosynthesis.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | Golgi apparatus | |
Cellular Component | Golgi membrane | |
Cellular Component | pollen tube | |
Molecular Function | polygalacturonate 4-alpha-galacturonosyltransferase activity | |
Biological Process | cell wall pectin biosynthetic process | |
Biological Process | mucilage pectin biosynthetic process | |
Biological Process | pollen development | |
Biological Process | pollen tube growth |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameProbable galacturonosyltransferase 14
- EC number
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ8GWT1
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Golgi apparatus membrane ; Single-pass type II membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-40 | Cytoplasmic | ||||
Sequence: MQLHISPSMRSITISSSNEFIDLMKIKVAARHISYRTLFH | ||||||
Transmembrane | 41-61 | Helical; Signal-anchor for type II membrane protein | ||||
Sequence: TILILAFLLPFVFILTAVVTL | ||||||
Topological domain | 62-532 | Lumenal | ||||
Sequence: EGVNKCSSIDCLGRRIGPRLLGRVDDSERLARDFYKILNEVSTQEIPDGLKLPNSFSQLVSDMKNNHYDAKTFALVLRAMMEKFERDMRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPEFLPVLSDNAYHHFILSTDNILAASVVVSSAVQSSSKPEKIVFHIITDKKTYAGMHSWFALNSVAPAIVEVKGVHQFDWLTRENVPVLEAVESHNGVRDYYHGNHVAGANLTETTPRTFASKLQSRSPKYISLLNHLRIYIPELFPNLDKVVFLDDDIVVQGDLTPLWDVDLGGKVNGAVETCRGEDEWVMSKRLRNYFNFSHPLIAKHLDPEECAWAYGMNIFDLQAWRKTNIRETYHSWLRENLKSNLTMWKLGTLPPALIAFKGHVHIIDSSWHMLGLGYQSKTNIENVKKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFIKNCHILE |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
No obvious phenotype (PubMed:19825675).
Increased galacturonic acid and Gal content in cell wall, but reduced xylose and rhamnose content (PubMed:19825675).
The gaut13 gaut14 double mutant is defective in male gametophyte function; swollen pollen tubes disturbed in elongation, and characterized by a disorganized outer layer cell wall with an altered repartition of pectin (e.g. homogalacturonan) (PubMed:23709340).
Increased galacturonic acid and Gal content in cell wall, but reduced xylose and rhamnose content (PubMed:19825675).
The gaut13 gaut14 double mutant is defective in male gametophyte function; swollen pollen tubes disturbed in elongation, and characterized by a disorganized outer layer cell wall with an altered repartition of pectin (e.g. homogalacturonan) (PubMed:23709340).
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 16 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000392564 | 1-532 | Probable galacturonosyltransferase 14 | |||
Sequence: MQLHISPSMRSITISSSNEFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFILTAVVTLEGVNKCSSIDCLGRRIGPRLLGRVDDSERLARDFYKILNEVSTQEIPDGLKLPNSFSQLVSDMKNNHYDAKTFALVLRAMMEKFERDMRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPEFLPVLSDNAYHHFILSTDNILAASVVVSSAVQSSSKPEKIVFHIITDKKTYAGMHSWFALNSVAPAIVEVKGVHQFDWLTRENVPVLEAVESHNGVRDYYHGNHVAGANLTETTPRTFASKLQSRSPKYISLLNHLRIYIPELFPNLDKVVFLDDDIVVQGDLTPLWDVDLGGKVNGAVETCRGEDEWVMSKRLRNYFNFSHPLIAKHLDPEECAWAYGMNIFDLQAWRKTNIRETYHSWLRENLKSNLTMWKLGTLPPALIAFKGHVHIIDSSWHMLGLGYQSKTNIENVKKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFIKNCHILE | ||||||
Glycosylation | 305 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 395 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 444 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 519 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Length532
- Mass (Da)60,823
- Last updated2003-03-01 v1
- Checksum861B689D5E772C62
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AL391143 EMBL· GenBank· DDBJ | CAC01746.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
CP002688 EMBL· GenBank· DDBJ | AED92165.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK118651 EMBL· GenBank· DDBJ | BAC43247.1 EMBL· GenBank· DDBJ | mRNA | ||
BT005899 EMBL· GenBank· DDBJ | AAO64834.1 EMBL· GenBank· DDBJ | mRNA |