Q8GUL2 · MOS14_ARATH
- ProteinTransportin MOS14
- GeneMOS14
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids958 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Functions as a nuclear import receptor for serine-arginine rich (SR) proteins. Regulates nuclear import of SR proteins that are required for proper splicing of the two resistance (R) genes SNC1 and RPS4, a crucial step for their functions in plant immunity.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | small GTPase binding | |
Biological Process | protein import into nucleus | |
Biological Process | regulation of RNA splicing |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameTransportin MOS14
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ8GUL2
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Semi-dwarf phenotype.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 34 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000436558 | 1-958 | Transportin MOS14 | |||
Sequence: MEHQNAVKEALNALYHHPDDTVRVHADRWLQNFQGTLDAWQVADNLLHDSSSNLETLIFCSQTLRSKVQRDFEELPPGAFQKLRQSLTTLLKKFHKGPPKVRTQISIAVAALAVHVPAADWGDGGIISWLRDEMHMHPEYVPGFLELLTVLPEETFNYKIAARPDRRRQFEKELTSQMEAALSILSACLKISELKEQVLEAFASWLRLRHGIPGTVLACHPLVHAALSSLNCDPLSEASVNVISELIHHTASPSSGGISAQTPLIQVIVPQILSLQAHLRDSSKDEEDVKAIGRLFADVGDSYVELIATGSDEPMVIVHALLEVTAHPEFDIASMTFNFWHSLQLMLTKRESYSSLGSEASIEVERNRRLHIFQPAYQSLVSLVGFRVQYPEDYQGLSYEDLKEFKQTRYAVADVLIDAALILGGDTTLKILYMKLLEANAQTGNNFQDWRPAEAILFCIWAISNYVSVVEAEVMPQVMALLQNLPQQAQLLQTACLLVGAYSKWLNAAPASVSILPSIIRILMSGMGTSEDCAAAAALAFRHTCDDCRKNLCGYFEDLFNIYCMAINGGGGYKVSAEDSLNLVEALGMVVTELPLDQAKGALEKLCFSAASPLEEAAKEDLEKKHARELTVHIDRFAFLFRYVNHPEAVAAEINKHWAIFRVIFDARPWDMRTMESLCRACKYAVRTSGRYIIDTIGEMLEKIQFHYQQHHQPCFLYLSSEVIKIFGSDPSCAVYLKNLIETLFAHTTCLMTSIKEVTARPDIADDCFLLASRCLRYCPHLFIPSPIFPALVNCAMIGITVQHREACHSILTFLTDIFDLEKSVNEEQFVRIRDNIIIPRGATITRILIASLAGALPSSRLDTVTYSLLALTRTYRLQAVSWAKESVSLIPRTALTETESTKFLQALSDIAYGADVNSLIGQVEELSDVCRRNRTVQELVQAALKPLELNLVTAPVS |
Proteomic databases
Expression
Gene expression databases
Interaction
Subunit
Interacts with RS2Z33, RSZ21, RS31A, SR34 and RAN1.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q8GUL2 | TIFY8 Q84MB2 | 3 | EBI-25520322, EBI-4426557 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 26-93 | Importin N-terminal | ||||
Sequence: ADRWLQNFQGTLDAWQVADNLLHDSSSNLETLIFCSQTLRSKVQRDFEELPPGAFQKLRQSLTTLLKK |
Sequence similarities
Belongs to the importin beta family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length958
- Mass (Da)106,917
- Last updated2003-03-01 v1
- Checksum6C1DC0E753DD7A0B
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB015469 EMBL· GenBank· DDBJ | BAB11510.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
AB020751 EMBL· GenBank· DDBJ | BAB11510.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
CP002688 EMBL· GenBank· DDBJ | AED97629.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BT002408 EMBL· GenBank· DDBJ | AAO00768.1 EMBL· GenBank· DDBJ | mRNA | ||
BT010552 EMBL· GenBank· DDBJ | AAQ65175.1 EMBL· GenBank· DDBJ | mRNA | ||
AK229829 EMBL· GenBank· DDBJ | BAF01659.1 EMBL· GenBank· DDBJ | mRNA | ||
AK230415 EMBL· GenBank· DDBJ | BAF02213.1 EMBL· GenBank· DDBJ | mRNA |