Q8F706 · Q8F706_LEPIN
- ProteinProtein translocase subunit SecD
- GenesecD
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids642 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Part of the Sec protein translocase complex. Interacts with the SecYEG preprotein conducting channel. SecDF uses the proton motive force (PMF) to complete protein translocation after the ATP-dependent function of SecA.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | plasma membrane | |
Molecular Function | protein-transporting ATPase activity | |
Biological Process | intracellular protein transmembrane transport | |
Biological Process | protein targeting | |
Biological Process | protein transport | |
Biological Process | protein transport by the Sec complex |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameProtein translocase subunit SecD
Gene names
Organism names
- Strain
- Taxonomic lineageBacteria > Spirochaetota > Spirochaetia > Leptospirales > Leptospiraceae > Leptospira
Accessions
- Primary accessionQ8F706
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Cell inner membrane ; Multi-pass membrane protein
Membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 473-491 | Helical | ||||
Sequence: VGMKAVLIGFVLVMFYMIL | ||||||
Transmembrane | 498-520 | Helical | ||||
Sequence: LVANAALFANIVILSALLSLMGF | ||||||
Transmembrane | 526-548 | Helical | ||||
Sequence: GFAGIILTVGMAVDANVIIYERI | ||||||
Transmembrane | 569-591 | Helical | ||||
Sequence: AFWTIIDSNVTTLISGILMIRLG | ||||||
Transmembrane | 597-617 | Helical | ||||
Sequence: GFAITLCWGIITSLFTSLFLS |
Keywords
- Cellular component
PTM/Processing
Proteomic databases
Interaction
Subunit
Forms a complex with SecF. Part of the essential Sec protein translocation apparatus which comprises SecA, SecYEG and auxiliary proteins SecDF. Other proteins may also be involved.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 204-261 | Protein translocase subunit SecDF P1 | ||||
Sequence: EKAKLIIDNRLTSQNLTEPQVRIQKDQDSIEVSLPGVTNSSQILEIIQNTETVEYRLE | ||||||
Domain | 348-452 | SecDF P1 head subdomain | ||||
Sequence: RKFVVLEKAIALDGRDMRDARPSFENNSFGYIVSFTLTSSGAEKFFEITSQNKGRNLAIVWGDKVVSAPTIRSAIAGGVAQIDGSFTKEEAVDLANVISEGALPI | ||||||
Domain | 456-622 | Protein export membrane protein SecD/SecF C-terminal | ||||
Sequence: VLEMRFIGPTLGIESIEVGMKAVLIGFVLVMFYMILIYRLSGLVANAALFANIVILSALLSLMGFTLTLPGFAGIILTVGMAVDANVIIYERIKEELRAGKSATVAVAQGFDNAFWTIIDSNVTTLISGILMIRLGNGPIKGFAITLCWGIITSLFTSLFLSRLVMD |
Sequence similarities
Belongs to the SecD/SecF family. SecD subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length642
- Mass (Da)72,162
- Last updated2010-06-15 v2
- ChecksumFF398D5CDB76DDA4
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AE010300 EMBL· GenBank· DDBJ | AAN48341.2 EMBL· GenBank· DDBJ | Genomic DNA |