Q8CIQ7 · DOCK3_MOUSE
- ProteinDedicator of cytokinesis protein 3
- GeneDock3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids2027 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Potential guanine nucleotide exchange factor (GEF). GEF proteins activate some small GTPases by exchanging bound GDP for free GTP. Its interaction with presenilin proteins as well as its ability to stimulate Tau/MAPT phosphorylation suggest that it may be involved in Alzheimer disease. Ectopic expression in nerve cells decreases the secretion of amyloid-beta APBA1 protein and lowers the rate of cell-substratum adhesion, suggesting that it may affect the function of some small GTPase involved in the regulation of actin cytoskeleton or cell adhesion receptors.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Cellular Component | plasma membrane | |
Molecular Function | GTPase activator activity | |
Molecular Function | guanyl-nucleotide exchange factor activity | |
Molecular Function | SH3 domain binding | |
Molecular Function | small GTPase binding | |
Biological Process | small GTPase-mediated signal transduction |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameDedicator of cytokinesis protein 3
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ8CIQ7
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
DOCK3 knockout mice show sensorimotor impairment and structural changes in several brain regions, including the spinal cord and cerebellum. Structural changes are consistent with central axonal dystrophy and include a disorganized cytoskeletons, and abnormal accumulation of autophagic vacuoles associated with impaired axonal transport. Common features of mutant mice are gait abnormalities, limb weakness, ataxia, and an impaired ability to swim.
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000189989 | 1-2027 | Dedicator of cytokinesis protein 3 | |||
Sequence: MWTPTEEEKYGVVICSFRGSVPQGLVLEIGETVQILEKCEGWYRGVSTKKPNVKGLFPANYIHLKKAIVSNRGQYETVVPLEDSIVTEVTTTLQEWASLWKQLYVKHKVDLFYKLRHVMNELIDLRRQLLSGHLTQDQVREVKRHITVRLDWGNEHLGLDLVPRKDFEVVDSDQISVSDLYKMHLSSRQSVQQSTSQVDTMRPRHGETCRMPVPYHFFFSLKSFTYNTIGEDSDVFFSLYDMREGKQISERFLVRLNKNGGPRNPEKIERMCALFTDLSSKDMKRDLYIVAHVIRIGRMLLNDSKKGPAHLHYRRPYGCAVLSILDVLQSLTELKEEKDFVLKVYTCNNESEWTQIHENIIRKSSTKYSAPSASHGLIISLQLFRGDMEQIRRENPMIFNRGLAITRKLGFPDVIMPGDIRNDLYLTLEKGDFERGGKSVQKNIEVTMYVLYADGEILKDCISLGSGEPNRSSYHSFVLYHSNSPRWGEIIKLPIPIDRFRGSHLRFEFRHCSTKDKGEKKLFGFAFSPLMRDDGTTLSDDIHELYVYKCDENSTFNNHALYLGLPCCKEDYNGCPNIPSSLIFQRSKESFFISTQLSSTKLTQNVDLLALLKWKAFPDRIMDILGRLRHVSGEEIVKFLQDILDTLFVILDDNTEKYGLLVFQSLVFIINLLRDIKYFHFRPVMDTYIQKHFAGALAYKELIRCLKWYMDCSAELIRQDHIQEAMRALEYLFKFIVQSRILYSRATCGMEEEQFRSSIQELFQSIRFVLSLDSRNSETLLFTQAALLNSFPTIFDELLQMFTVQEVAEFVRGTLGSMPSTVHIGQSMDVVKLQSIARTVDSRLFSFSESRRILLPVVLHHIHLHLRQQKELLICSGILGSIFSIVKTSSLEADVMEEVEMMVESLLDVLLQTLLTIMSKSHAQEAVRGHCPVTAEITGEYVSCLLSLLRQMCDTHFQHLLDNFQSKDELKEFLLKIFCVFRNLMKMSVFPRDWMVMRLLTSNIIVTTVQYLSSALHKNFTETDFDFKVWNSYFSLAVLFINQPSLQLEIITSAKRKKILDKYGDMRVMMAYELFSMWQNLGEHKIHFIPGMIGPFLGVTLVPQPEVRNIMIPIFHDMMDWEQRKNGNFKQVEAELIDKLDSMVSEGKGDESYRELFGLLTQLFGPYPSLLEKVEQETWRETGISFVTSVTRLMERLLDYRDCMKGEETENKKVGCTVNLMNFYKSEINKEEMYIRYIHKLCDMHLQAENYTEAAFTLLLYCELLQWEDRPLREFLHYPSQTEWQRKEGLCRKIIHYFNKGKSWEFGIPLCRELACQYESLYDYQSLSWIRKMEASYYDNIIEQQRLEPEFFRVGFYGRKFPFFLRNKEYVCRGHDYERLEAFQQRMLSEFPQAVAMQHPNHPDDAILQCDAQYLQIYAVTPIPDYVDVLQMDRVPDRVKSFYRVNNVRKFRYDRPFHKGPKDKDNEFKSLWIERTTLTLTHSLPGISRWFEVERRELVEVSPLENAIQVVENKNQELRALISQYQHKQVHGNINLLSMCLNGVIDAAVNGGIARYQEAFFDKDYITKHPGDAEKISQLKELMQEQVHVLGVGLAVHEKFVHPEMRPLHKKLIDQFQMMRASLYHEFPGLDKLSPACSGTSTPRGNVLASHSPMSPENIKMTHRHSPMNLMGTGRHSSSSLSSHASSEAGNMMMMGDNSMGEAPEDLYHHMQLAYHNPRYQGSVTNVSVLSSSQASPSSSSLSSTHSAPSQMITSAPSSTRGSPSLPDKYRHAREMMLLLPTHRDRPSSAMYPAAILENGQPPNFQRALFQQVVGACKPCSDPNLSMAEKGHYSLHFDAFHHPLGDTPPALPARTLRKSPLHPIPASPTSPQSGLDGSNSTLSGSASSGVSSLSESNFGHSSEAPPRTDTMDSMPSQAWNGDEGLEPPYLPVHYSLSESAVLDAIKSQPCRSHSAPGCVLPQDPMDPPALPPKPYHPRLPALEHDEGMLLREEAERPRGLHRKASLPPGSVKEEQARLAWEHGRGEQ | ||||||
Modified residue | 1655 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in brain, spinal cord, pituitary gland, testis (PubMed:19129390).
Not expressed in heart, liver, kidney, spleen and lung. In brain, it is highly expressed in the cerebral cortex and hippocampus, while it is absent in other tissues, except in spinal cord. In the cerebral cortex, it is found within the intermediate (III and IV) and deep (V and VI) layers, whereas it is weakly expressed in superficial layer I. It is also abundant in the piriform cortex. Within the hippocampus, it is expressed in the pyramidal neurons of the CA1, CA2, and CA3 regions and the dentate gyrus
Not expressed in heart, liver, kidney, spleen and lung. In brain, it is highly expressed in the cerebral cortex and hippocampus, while it is absent in other tissues, except in spinal cord. In the cerebral cortex, it is found within the intermediate (III and IV) and deep (V and VI) layers, whereas it is weakly expressed in superficial layer I. It is also abundant in the piriform cortex. Within the hippocampus, it is expressed in the pyramidal neurons of the CA1, CA2, and CA3 regions and the dentate gyrus
Structure
Family & Domains
Features
Showing features for domain, compositional bias, region, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 6-67 | SH3 | ||||
Sequence: EEEKYGVVICSFRGSVPQGLVLEIGETVQILEKCEGWYRGVSTKKPNVKGLFPANYIHLKKA | ||||||
Domain | 421-598 | C2 DOCK-type | ||||
Sequence: RNDLYLTLEKGDFERGGKSVQKNIEVTMYVLYADGEILKDCISLGSGEPNRSSYHSFVLYHSNSPRWGEIIKLPIPIDRFRGSHLRFEFRHCSTKDKGEKKLFGFAFSPLMRDDGTTLSDDIHELYVYKCDENSTFNNHALYLGLPCCKEDYNGCPNIPSSLIFQRSKESFFISTQLS | ||||||
Domain | 1225-1632 | DOCKER | ||||
Sequence: KSEINKEEMYIRYIHKLCDMHLQAENYTEAAFTLLLYCELLQWEDRPLREFLHYPSQTEWQRKEGLCRKIIHYFNKGKSWEFGIPLCRELACQYESLYDYQSLSWIRKMEASYYDNIIEQQRLEPEFFRVGFYGRKFPFFLRNKEYVCRGHDYERLEAFQQRMLSEFPQAVAMQHPNHPDDAILQCDAQYLQIYAVTPIPDYVDVLQMDRVPDRVKSFYRVNNVRKFRYDRPFHKGPKDKDNEFKSLWIERTTLTLTHSLPGISRWFEVERRELVEVSPLENAIQVVENKNQELRALISQYQHKQVHGNINLLSMCLNGVIDAAVNGGIARYQEAFFDKDYITKHPGDAEKISQLKELMQEQVHVLGVGLAVHEKFVHPEMRPLHKKLIDQFQMMRASLYHEFPGLDK | ||||||
Compositional bias | 1672-1693 | Polar residues | ||||
Sequence: GTGRHSSSSLSSHASSEAGNMM | ||||||
Region | 1672-1695 | Disordered | ||||
Sequence: GTGRHSSSSLSSHASSEAGNMMMM | ||||||
Compositional bias | 1731-1765 | Polar residues | ||||
Sequence: SSSQASPSSSSLSSTHSAPSQMITSAPSSTRGSPS | ||||||
Region | 1731-1768 | Disordered | ||||
Sequence: SSSQASPSSSSLSSTHSAPSQMITSAPSSTRGSPSLPD | ||||||
Region | 1846-1925 | Disordered | ||||
Sequence: DTPPALPARTLRKSPLHPIPASPTSPQSGLDGSNSTLSGSASSGVSSLSESNFGHSSEAPPRTDTMDSMPSQAWNGDEGL | ||||||
Compositional bias | 1868-1917 | Polar residues | ||||
Sequence: PTSPQSGLDGSNSTLSGSASSGVSSLSESNFGHSSEAPPRTDTMDSMPSQ | ||||||
Motif | 1967-1973 | SH3-binding | ||||
Sequence: PPALPPK | ||||||
Region | 1971-2027 | Disordered | ||||
Sequence: PPKPYHPRLPALEHDEGMLLREEAERPRGLHRKASLPPGSVKEEQARLAWEHGRGEQ | ||||||
Compositional bias | 1978-2002 | Basic and acidic residues | ||||
Sequence: RLPALEHDEGMLLREEAERPRGLHR |
Domain
The DOCKER domain may mediate some GEF activity.
Sequence similarities
Belongs to the DOCK family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length2,027
- Mass (Da)232,910
- Last updated2003-03-01 v1
- Checksum006DCE0B4583A1CC
Computationally mapped potential isoform sequences
There are 5 potential isoforms mapped to this entry
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1672-1693 | Polar residues | ||||
Sequence: GTGRHSSSSLSSHASSEAGNMM | ||||||
Compositional bias | 1731-1765 | Polar residues | ||||
Sequence: SSSQASPSSSSLSSTHSAPSQMITSAPSSTRGSPS | ||||||
Compositional bias | 1868-1917 | Polar residues | ||||
Sequence: PTSPQSGLDGSNSTLSGSASSGVSSLSESNFGHSSEAPPRTDTMDSMPSQ | ||||||
Compositional bias | 1978-2002 | Basic and acidic residues | ||||
Sequence: RLPALEHDEGMLLREEAERPRGLHR |
Keywords
- Technical term