Q8C7N7 · APH1B_MOUSE
- ProteinGamma-secretase subunit APH-1B
- GeneAph1b
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids257 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Probable subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral proteins such as Notch receptors and APP (amyloid-beta precursor protein). It probably represents a stabilizing cofactor for the presenilin homodimer that promotes the formation of a stable complex. Probably present in a minority of gamma-secretase complexes compared to APH1A (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | endoplasmic reticulum | |
Cellular Component | gamma-secretase complex | |
Cellular Component | Golgi membrane | |
Cellular Component | plasma membrane | |
Cellular Component | synapse | |
Molecular Function | protein-macromolecule adaptor activity | |
Biological Process | amyloid precursor protein catabolic process | |
Biological Process | amyloid-beta formation | |
Biological Process | locomotory behavior | |
Biological Process | membrane protein ectodomain proteolysis | |
Biological Process | membrane protein intracellular domain proteolysis | |
Biological Process | Notch receptor processing | |
Biological Process | Notch signaling pathway | |
Biological Process | prepulse inhibition | |
Biological Process | protein processing | |
Biological Process | short-term memory | |
Biological Process | synaptic transmission, dopaminergic | |
Biological Process | synaptic transmission, glutamatergic |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameGamma-secretase subunit APH-1B
- Short namesAPH-1b
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ8C7N7
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 5-25 | Helical; Name=1 | ||||
Sequence: VFFGCAFIAFGPALALYVFTI | ||||||
Transmembrane | 32-52 | Helical; Name=2 | ||||
Sequence: VIFLIAGAFFWLVSLLLSSVF | ||||||
Transmembrane | 66-86 | Helical; Name=3 | ||||
Sequence: PVQNYLLIFGVLLSVCIQELF | ||||||
Transmembrane | 115-135 | Helical; Name=4 | ||||
Sequence: LLAYVSGLGFGIMSGVFSFVN | ||||||
Transmembrane | 160-180 | Helical; Name=5 | ||||
Sequence: AFMTLVVIMLHVFWGVVFFDG | ||||||
Transmembrane | 186-206 | Helical; Name=6 | ||||
Sequence: WYTLLTVLLTHLVVSTQTFLS | ||||||
Transmembrane | 213-233 | Helical; Name=7 | ||||
Sequence: LVTAYIIMVLMGIWAFYVAGG |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000221053 | 1-257 | Gamma-secretase subunit APH-1B | |||
Sequence: MTAAVFFGCAFIAFGPALALYVFTIATDPLRVIFLIAGAFFWLVSLLLSSVFWFLVRVITDNRDGPVQNYLLIFGVLLSVCIQELFRLAYYKLLKKASEGLKSINPEETAPSMRLLAYVSGLGFGIMSGVFSFVNTLSNSLGPGTVGIHGDSPQFFLNSAFMTLVVIMLHVFWGVVFFDGCEKNKWYTLLTVLLTHLVVSTQTFLSPYYEVNLVTAYIIMVLMGIWAFYVAGGSCRSLKLCLLCQDKDFLLYNQRSR |
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Subunit
Probable component of the gamma-secretase complex, a complex composed of a presenilin homodimer (PSEN1 or PSEN2), nicastrin (NCSTN), APH1 (APH1A or APH1B) and PEN2. Such minimal complex is sufficient for secretase activity, although other components may exist (By similarity).
Interacts with PSEN1 and PSEN2 (By similarity).
Interacts with PSEN1 and PSEN2 (By similarity).
Protein-protein interaction databases
Miscellaneous
Structure
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q8C7N7-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length257
- Mass (Da)28,703
- Last updated2003-03-01 v1
- Checksum52D39310695ED96A
Q8C7N7-2
- Name2
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
F8WHK7 | F8WHK7_MOUSE | Aph1b | 216 |
Features
Showing features for alternative sequence.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK028521 EMBL· GenBank· DDBJ | BAC25988.1 EMBL· GenBank· DDBJ | mRNA | ||
AK049828 EMBL· GenBank· DDBJ | BAC33940.1 EMBL· GenBank· DDBJ | mRNA | ||
AK154847 EMBL· GenBank· DDBJ | BAE32873.1 EMBL· GenBank· DDBJ | mRNA | ||
BC079659 EMBL· GenBank· DDBJ | AAH79659.1 EMBL· GenBank· DDBJ | mRNA |