Q8C7E7 · STBD1_MOUSE
- ProteinStarch-binding domain-containing protein 1
- GeneStbd1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids338 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Acts as a cargo receptor for glycogen. Delivers its cargo to an autophagic pathway called glycophagy, resulting in the transport of glycogen to lysosomes.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | endoplasmic reticulum membrane | |
Cellular Component | membrane | |
Cellular Component | perinuclear region of cytoplasm | |
Cellular Component | phagophore assembly site membrane | |
Cellular Component | T-tubule | |
Molecular Function | cargo receptor activity | |
Molecular Function | enzyme binding | |
Molecular Function | glycogen binding | |
Molecular Function | starch binding | |
Biological Process | glycogen catabolic process | |
Biological Process | glycophagy | |
Biological Process | intracellular transport | |
Biological Process | substrate localization to autophagosome |
Keywords
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameStarch-binding domain-containing protein 1
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ8C7E7
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Preautophagosomal structure membrane ; Single-pass type III membrane protein
Endoplasmic reticulum membrane ; Single-pass type III membrane protein
Note: Also detected near the junctional sarcoplasmic reticulum (By similarity).
Concentrates at perinuclear structures (PubMed:20810658).
Concentrates at perinuclear structures (PubMed:20810658).
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-6 | Extracellular | ||||
Sequence: MGAVWS | ||||||
Transmembrane | 7-23 | Helical | ||||
Sequence: ALLVGGGLAGALILWLL | ||||||
Topological domain | 24-338 | Cytoplasmic | ||||
Sequence: RGDSGAPGKDGVAEPPQKGAPPGEAAAPGDGPGGGGSGGLSPEPSDRELVSKAEHLRESNGHLISESKDLGNLPEAQRLQNVGADWVNAREFVPVGKIPDTHSRADSEAARNQSPGSHGGEWRLPKGQETAVKVAGSVAAKLPSSSLLVDRAKAVSQDQAGHEDWEVVSRHSSWGSVGLGGSLEASRLSLNQRMDDSTNSLVGGRGWEVDGKVASLKPQQVSIQFQVHYTTNTDVQFIAVTGDHESLGRWNTYIPLHYCKDGLWSHSVFLPADTVVEWKFVLVENKEVTRWEECSNRFLQTGHEDKVVHGWWGIH |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000238961 | 1-338 | Starch-binding domain-containing protein 1 | |||
Sequence: MGAVWSALLVGGGLAGALILWLLRGDSGAPGKDGVAEPPQKGAPPGEAAAPGDGPGGGGSGGLSPEPSDRELVSKAEHLRESNGHLISESKDLGNLPEAQRLQNVGADWVNAREFVPVGKIPDTHSRADSEAARNQSPGSHGGEWRLPKGQETAVKVAGSVAAKLPSSSLLVDRAKAVSQDQAGHEDWEVVSRHSSWGSVGLGGSLEASRLSLNQRMDDSTNSLVGGRGWEVDGKVASLKPQQVSIQFQVHYTTNTDVQFIAVTGDHESLGRWNTYIPLHYCKDGLWSHSVFLPADTVVEWKFVLVENKEVTRWEECSNRFLQTGHEDKVVHGWWGIH | ||||||
Modified residue | 68 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 140 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 167 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 179 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 195 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 196 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 205 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 209 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 212 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 220 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 223 | Phosphoserine | ||||
Sequence: S |
Post-translational modification
Ubiquitinated, which leads to proteasomal degradation.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed at high level in glycogen-accumulating organs such as muscle and liver. Trace signals are also found in brain, kidney, and pancreas.
Gene expression databases
Interaction
Subunit
Interacts with the ATG8 family proteins GABARAP and GABARAPL1 (By similarity).
Interacts with several glycogen-associated proteins, such as GYS2 (liver glycogen synthase), GDE (glycogen debranching enzyme), GBE1 (glycogen branching enzyme 1) and EPM2A (Laforin) (By similarity).
Interacts with several glycogen-associated proteins, such as GYS2 (liver glycogen synthase), GDE (glycogen debranching enzyme), GBE1 (glycogen branching enzyme 1) and EPM2A (Laforin) (By similarity).
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, motif, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 30-73 | Disordered | ||||
Sequence: PGKDGVAEPPQKGAPPGEAAAPGDGPGGGGSGGLSPEPSDRELV | ||||||
Region | 120-148 | Disordered | ||||
Sequence: KIPDTHSRADSEAARNQSPGSHGGEWRLP | ||||||
Motif | 185-191 | LIR | ||||
Sequence: HEDWEVV | ||||||
Domain | 238-337 | CBM20 | ||||
Sequence: SLKPQQVSIQFQVHYTTNTDVQFIAVTGDHESLGRWNTYIPLHYCKDGLWSHSVFLPADTVVEWKFVLVENKEVTRWEECSNRFLQTGHEDKVVHGWWGI |
Domain
The LIR motif (LC3-interacting region) is required for the interaction with the ATG8 family protein GABARAPL1.
The C-terminal CBM20 domain is required for the interaction with glycogen.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length338
- Mass (Da)36,127
- Last updated2003-03-01 v1
- Checksum66C12554D9C9EC59
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0J9YUR6 | A0A0J9YUR6_MOUSE | Stbd1 | 79 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK050416 EMBL· GenBank· DDBJ | BAC34244.1 EMBL· GenBank· DDBJ | mRNA | ||
BC118661 EMBL· GenBank· DDBJ | AAI18662.1 EMBL· GenBank· DDBJ | mRNA |