Q8C6G1 · CF410_MOUSE
- ProteinCilia- and flagella-associated protein 410
- GeneCfap410
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids249 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Plays a role in cilia formation and/or maintenance (PubMed:21289087).
Plays a role in the regulation of cell morphology and cytoskeletal organization (By similarity).
Involved in DNA damage repair (By similarity).
Plays a role in the regulation of cell morphology and cytoskeletal organization (By similarity).
Involved in DNA damage repair (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | ciliary basal body | |
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Cellular Component | mitochondrion | |
Cellular Component | photoreceptor cell cilium | |
Cellular Component | photoreceptor connecting cilium | |
Cellular Component | photoreceptor outer segment | |
Cellular Component | plasma membrane | |
Biological Process | cilium assembly | |
Biological Process | cytoskeleton organization | |
Biological Process | DNA damage response | |
Biological Process | regulation of cell shape | |
Biological Process | smoothened signaling pathway |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameCilia- and flagella-associated protein 410
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ8C6G1
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Cilia absent or reduced, virtually no cilia of the normal 5 uM mean length.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 13 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000419170 | 1-249 | Cilia- and flagella-associated protein 410 | |||
Sequence: MKLTRKMVLSRAKASELHNVRKLNCWGSQLTDISICREMPSLEVITLSVNSVSTLEPVRSCRRLSELYLRRNRIPSLNELFYLKDLPHLRVLWLAENPCCGTSPHLYRMTVLRNLPHLQKLDNQAVTEEELTRALMEGDEITAAPHREGAGNGCPKPPYALNSVSSATETSQHLLSYTEETEVQGQTTTDQSPSFSPRDTMRSHKNRNILTAILLLLRELDTEGLETVQQTVGSRLQALHRPEPQEDME |
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in the retina.
Induction
Up-regulated during cartilage differentiation (PubMed:26974433).
Gene expression databases
Structure
Family & Domains
Features
Showing features for repeat, domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 19-40 | LRR 1 | ||||
Sequence: NVRKLNCWGSQLTDISICREMP | ||||||
Repeat | 41-62 | LRR 2 | ||||
Sequence: SLEVITLSVNSVSTLEPVRSCR | ||||||
Repeat | 63-84 | LRR 3 | ||||
Sequence: RLSELYLRRNRIPSLNELFYLK | ||||||
Domain | 97-137 | LRRCT | ||||
Sequence: NPCCGTSPHLYRMTVLRNLPHLQKLDNQAVTEEELTRALME | ||||||
Region | 146-203 | Disordered | ||||
Sequence: HREGAGNGCPKPPYALNSVSSATETSQHLLSYTEETEVQGQTTTDQSPSFSPRDTMRS | ||||||
Compositional bias | 159-199 | Polar residues | ||||
Sequence: YALNSVSSATETSQHLLSYTEETEVQGQTTTDQSPSFSPRD |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length249
- Mass (Da)28,239
- Last updated2003-03-01 v1
- ChecksumF3B26A152BFB1819
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q3U699 | Q3U699_MOUSE | Cfap410 | 212 |
Features
Showing features for compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 159-199 | Polar residues | ||||
Sequence: YALNSVSSATETSQHLLSYTEETEVQGQTTTDQSPSFSPRD | ||||||
Sequence conflict | 162 | in Ref. 4; AAH10330 | ||||
Sequence: N → H | ||||||
Sequence conflict | 206 | in Ref. 4; AAH10330 | ||||
Sequence: N → S |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK075794 EMBL· GenBank· DDBJ | BAC35963.1 EMBL· GenBank· DDBJ | mRNA | ||
AC158612 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH466553 EMBL· GenBank· DDBJ | EDL31765.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC010330 EMBL· GenBank· DDBJ | AAH10330.1 EMBL· GenBank· DDBJ | mRNA |