Q8C267 · SETB2_MOUSE
- ProteinHistone-lysine N-methyltransferase SETDB2
- GeneSetdb2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids713 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Catalytic activity
- N6,N6-dimethyl-L-lysyl9-[histone H3] + S-adenosyl-L-methionine = H+ + N6,N6,N6-trimethyl-L-lysyl9-[histone H3] + S-adenosyl-L-homocysteine
RHEA-COMP:15541 CHEBI:61976 Position: 9+ CHEBI:59789 = CHEBI:15378 + RHEA-COMP:15538 CHEBI:61961 Position: 9+ CHEBI:57856
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 296 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 296 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 298 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 302 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 302 | Zn2+ 3 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 308 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 310 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 348 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 348 | Zn2+ 3 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 352 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 354 | Zn2+ 3 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 359 | Zn2+ 3 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 380-382 | S-adenosyl-L-methionine (UniProtKB | ChEBI) | ||||
Sequence: KGW | ||||||
Binding site | 642 | S-adenosyl-L-methionine (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 645-646 | S-adenosyl-L-methionine (UniProtKB | ChEBI) | ||||
Sequence: NH | ||||||
Binding site | 648 | Zn2+ 4 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 701 | Zn2+ 4 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 703 | Zn2+ 4 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 708 | Zn2+ 4 (UniProtKB | ChEBI) | ||||
Sequence: C |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chromosome | |
Cellular Component | cytosol | |
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Molecular Function | DNA binding | |
Molecular Function | histone H3K9 methyltransferase activity | |
Molecular Function | histone H3K9 monomethyltransferase activity | |
Molecular Function | zinc ion binding | |
Biological Process | cell division | |
Biological Process | chromosome segregation | |
Biological Process | heart looping | |
Biological Process | heterochromatin organization | |
Biological Process | left/right axis specification | |
Biological Process | methylation | |
Biological Process | mitotic cell cycle | |
Biological Process | negative regulation of DNA-templated transcription | |
Biological Process | negative regulation of gene expression | |
Biological Process | positive regulation of DNA methylation-dependent heterochromatin formation |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
SETDB2 regulates macrophage plasticity during normal and pathologic wound repair.
SETDB2 somehow promotes trimethylation of H3K9, but it is not a histone methyl-transferase itself.
SETDB2 seems to play a role as a regulator of the immune system in acute respiratory viral infection. It is an ISG (interferon stimulated gene), induced late during the secondary response (IFNAR dependent), and appears to play a role as a paradoxical component in the system, presumably aiding in putting an end to the interferon response. As such, it appears to adversely promote IAV replication, as it is over-expressed over an extended period upon IAV infection).
SETDB2 is an ISG (interferon stimulated gene), induced late during the secondary response (IFNAR dependent), and appears to play a role as a paradoxical component in the system, presumably aiding in putting an end to the interferon response. As such, it appears to adversely promote bacterial super-infection occurring after influenza infection.
Names & Taxonomy
Protein names
- Recommended nameHistone-lysine N-methyltransferase SETDB2
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ8C267
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000281824 | 1-713 | Histone-lysine N-methyltransferase SETDB2 | |||
Sequence: MEEKNGDAKTFWMELQDDGKVDLMFEKTQNVLHSLKQKIKDGSATNGDYVQAMNLVNEATLSNTQTLEKGMFITYSNPEVNTHRSNHTPVTQSEQENKSSAVPSASCDNSCPKGCTIPSPGKKVFLPVKNKADNLVKKEAPLHISFHRHICSRTCLMETPLSLKGENPLQLPIRCHFQRRHAKTNSHSSALHVNYKTPCGRNLRNMEEVFHYLLETECNFLFTDNFSFNTYVQLTRNHPKQNEVVSDVDISNGVESVSIPFCNEIDNSKLPRFKYRNTVWPRIYHLNFSNMFSDSCDCSEGCIDIKKCACLQLTAKNAKACPLSSDGECAGYKYKRLQRLIPTGIYECNLLCKCNKQMCQNRVIQHGVRVRLQVFKSEKKGWGVRCLDDIDKGTFVCIYSGRLLRRATPEKTNIGENGREQQHIVKNSFSKKRKLEVVCSDCDAHCDSPKAEDCPPKLSGDLKEPAVEMNHRNISRTQHHSVIRRTKSKTTVFHYSEKNMGFVCSDSAAPEDKNGFKPAQEHVNSEARRAHEDLSSNPAGDSEDTQLTESDVIDITASREDSAPAYRCKHATIVDRKDTKQVLEVPGKKSQEEEPAASQSQQALCDEELPSERTKIPSASLMQLSKESLFLLDASKEGNVGRFLNHSCCPNLWVQNVFVETHDRNFPLVAFFTNRYVKARTELTWDYGYEAGATPAKEILCQCGFNKCRKKLI |
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, domain, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 78-109 | Disordered | ||||
Sequence: PEVNTHRSNHTPVTQSEQENKSSAVPSASCDN | ||||||
Domain | 161-233 | MBD | ||||
Sequence: LSLKGENPLQLPIRCHFQRRHAKTNSHSSALHVNYKTPCGRNLRNMEEVFHYLLETECNFLFTDNFSFNTYVQ | ||||||
Domain | 294-367 | Pre-SET | ||||
Sequence: DSCDCSEGCIDIKKCACLQLTAKNAKACPLSSDGECAGYKYKRLQRLIPTGIYECNLLCKCNKQMCQNRVIQHG | ||||||
Domain | 370-688 | SET | ||||
Sequence: VRLQVFKSEKKGWGVRCLDDIDKGTFVCIYSGRLLRRATPEKTNIGENGREQQHIVKNSFSKKRKLEVVCSDCDAHCDSPKAEDCPPKLSGDLKEPAVEMNHRNISRTQHHSVIRRTKSKTTVFHYSEKNMGFVCSDSAAPEDKNGFKPAQEHVNSEARRAHEDLSSNPAGDSEDTQLTESDVIDITASREDSAPAYRCKHATIVDRKDTKQVLEVPGKKSQEEEPAASQSQQALCDEELPSERTKIPSASLMQLSKESLFLLDASKEGNVGRFLNHSCCPNLWVQNVFVETHDRNFPLVAFFTNRYVKARTELTWDYG | ||||||
Region | 511-549 | Disordered | ||||
Sequence: EDKNGFKPAQEHVNSEARRAHEDLSSNPAGDSEDTQLTE | ||||||
Compositional bias | 515-538 | Basic and acidic residues | ||||
Sequence: GFKPAQEHVNSEARRAHEDLSSNP | ||||||
Region | 579-608 | Disordered | ||||
Sequence: TKQVLEVPGKKSQEEEPAASQSQQALCDEE | ||||||
Compositional bias | 593-607 | Polar residues | ||||
Sequence: EEPAASQSQQALCDE |
Domain
Sequence similarities
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q8C267-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length713
- Mass (Da)80,636
- Last updated2007-04-03 v2
- ChecksumC4E750F01ED4231A
Q8C267-2
- Name2
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
B2RXP3 | B2RXP3_MOUSE | Setdb2 | 697 |
Features
Showing features for alternative sequence, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_024063 | 70-86 | in isoform 2 | |||
Sequence: GMFITYSNPEVNTHRSN → D | ||||||
Alternative sequence | VSP_024064 | 119-156 | in isoform 2 | |||
Sequence: SPGKKVFLPVKNKADNLVKKEAPLHISFHRHICSRTCL → YVYVIRVSAPSVCCLLNIPKSLTPFIKFNSRCLCLLVN | ||||||
Alternative sequence | VSP_024065 | 157-713 | in isoform 2 | |||
Sequence: Missing | ||||||
Compositional bias | 515-538 | Basic and acidic residues | ||||
Sequence: GFKPAQEHVNSEARRAHEDLSSNP | ||||||
Compositional bias | 593-607 | Polar residues | ||||
Sequence: EEPAASQSQQALCDE |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK089197 EMBL· GenBank· DDBJ | BAC40789.1 EMBL· GenBank· DDBJ | mRNA | ||
AC114007 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |