Q8BWJ3 · KPB2_MOUSE
- ProteinPhosphorylase b kinase regulatory subunit alpha, liver isoform
- GenePhka2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids1235 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Phosphorylase b kinase catalyzes the phosphorylation of serine in certain substrates, including troponin I. The alpha chain may bind calmodulin.
Activity regulation
By phosphorylation of various serine residues and by calcium.
Pathway
Glycan biosynthesis; glycogen metabolism.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | phosphorylase kinase complex | |
Cellular Component | plasma membrane | |
Molecular Function | calmodulin binding | |
Biological Process | glycogen metabolic process |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namePhosphorylase b kinase regulatory subunit alpha, liver isoform
- Short namesPhosphorylase kinase alpha L subunit
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ8BWJ3
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain, modified residue, lipidation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000057731 | 1-1235 | Phosphorylase b kinase regulatory subunit alpha, liver isoform | |||
Sequence: MRSRSNSGVRLDGYARLVQQTILCYQNPVTGLLSASHDQKDAWVRDNIYSILAVWGLGMAYRKNADRDEDKAKAYELEQNVVKLMRGLLQCMMRQVDKVEKFKHTQSTKDSLHAKYNTATCSTVVGDDQWGHLQVDATSLFLLFLAQMTASGLRIIFTLDEVAFIQNLVFYIEAAYKVADYGMWERGDKTNQGIPELNASSVGVAKAALEAIDELDLFGAHGGRKSVIHVLPDEVEHCQSILFSMLPRASTSKEIDAGLLSIISFPAFAVEDVNLVNVTKNEIISKLQGRYGCCRFLRDGYKTPREDPHRLHYDPAELKLFENIECEWPVFWTYLIIDGIFNGDAVQVQEYREALEGILIRGKDGIHLVPELYAIPPDKVDEEYKNPHTVDRVPLGKLPHLWGQSLYILSSLLAEGFLATGEIDPLNRRFSTSVKPDVVVQVAVLAENSHIKGLLKEHGMTVQSIADVHPIRVQPGRILSHIYAKLGRNKNMKLSGRPYRHIGVLGTSKLYVIRNHIFTFTPQFTDQHHFYLALDNEMIVEMLRIELAYLCTCWRMTGRPTLTFPVTHTMLTNDGSDIHPAVLSTIRKLEDGYFGGARVKLGNLAEFLTTSFYTHLTFLDPDCDEKLFGDITDRSFSPDSEPDLGGYLEDSSPQESQDELDQYISHLLQSTSLKCYLPPLCKKSEDSHFFSAIHSTRDILSVMAKAKGLETTFFPMILPTKVLSGHRKSLNLVDSPQPLLKTTPEYDYQWPRDDHDEVDCEKLVGQLKDCSNLQDQADILYILYVMKGPRWDTNLFGQHGVTVHSLLSELYGKAGLNQEWSLIRYISGLLRKKVEVLAEACADLLSHQKQLTVGLPPEPREKTISTPLPPEELTELIYEASGQDISIAVLTQEIVVYLAMYVRAQPSLFAEMLRLRIGLIIQVMATELARSLNCSGKEASESLMNLSPFDMKSLLHHILSGKEFGVERSVRPIHSSMSSPAISIHEVGHTGATKTERSGITRLRSEMKQMNRRASADEQFFPLGQTMSNSLHSIKSVRSSTPSSPTGTSSTDSGGQHLGWGEQQGQWLRRRRLDGAINRVPVGFYQKVWKILQKCHGLSIDGYVLPSSTTQEMTPCEIKFAVHVESVLNRVSQPEYRQLLVEAIMVLTLLSDTEMDSIGGIIHVDQIVQLANQLFLQDQVSFGTTDILEKDQATGICHLFYDSAPSGAYGTMTYLTKAVASHLQELLPSSGCQMQ | ||||||
Modified residue | 695 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 729 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 735 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 983 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 1015 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 1044 | Phosphoserine | ||||
Sequence: S | ||||||
Lipidation | 1232 | S-farnesyl cysteine | ||||
Sequence: C |
Post-translational modification
Although the final Cys may be farnesylated, the terminal tripeptide is probably not removed, and the C-terminus is not methylated.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Subunit
Hexadecamer of 4 heterotetramers, each composed of alpha, beta, gamma, and delta subunits. Alpha (PHKA1 or PHKA2) and beta (PHKB) are regulatory subunits, gamma (PHKG1 or PHKG2) is the catalytic subunit, and delta is calmodulin (By similarity).
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 636-655 | Disordered | ||||
Sequence: FSPDSEPDLGGYLEDSSPQE | ||||||
Region | 807-837 | Calmodulin-binding | ||||
Sequence: LSELYGKAGLNQEWSLIRYISGLLRKKVEVL | ||||||
Region | 1033-1060 | Disordered | ||||
Sequence: SIKSVRSSTPSSPTGTSSTDSGGQHLGW | ||||||
Region | 1059-1099 | Calmodulin-binding | ||||
Sequence: GWGEQQGQWLRRRRLDGAINRVPVGFYQKVWKILQKCHGLS |
Sequence similarities
Belongs to the phosphorylase b kinase regulatory chain family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,235
- Mass (Da)138,492
- Last updated2003-03-01 v1
- Checksum81B6EC538B0228CC
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK052346 EMBL· GenBank· DDBJ | BAC34948.1 EMBL· GenBank· DDBJ | mRNA | ||
AK165506 EMBL· GenBank· DDBJ | BAE38224.1 EMBL· GenBank· DDBJ | mRNA | ||
BC050040 EMBL· GenBank· DDBJ | AAH50040.1 EMBL· GenBank· DDBJ | mRNA | Different initiation |