Q8BW74 · HLF_MOUSE
- ProteinHepatic leukemia factor
- GeneHlf
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids295 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
Miscellaneous
Mice deficient for all three PAR bZIP proteins (DBP, HLF and TEF) display a dramatically shortened life span and are highly susceptible to generalized spontaneous and audiogenic epilepsies (due for example to the noise of a vacuum cleaner) that are frequently lethal. The down-regulation of pyridoxal kinase (Pdxk) expression in these mice may participate in this seizure phenotype.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Cellular Component | RNA polymerase II transcription regulator complex | |
Molecular Function | DNA-binding transcription activator activity, RNA polymerase II-specific | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding | |
Biological Process | regulation of transcription by RNA polymerase II | |
Biological Process | rhythmic process | |
Biological Process | skeletal muscle cell differentiation |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameHepatic leukemia factor
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ8BW74
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000076511 | 1-295 | Hepatic leukemia factor | |||
Sequence: MEKMSRQLPLNPTFIPPPYGVLRSLLENPLKLPLHPEDAFSKEKDKGKKLDDESSSPTVPQSAFLGPTLWDKTLPYDGDTFQLEYMDLEEFLSENGIPPSPSQHDHSPHPPGLQPASSTAPSVMDLSSRATAPLHPGIPSPNCMQSPIRPGQLLPANRNTPSPIDPDTIQVPVGYEPDPADLALSSIPGQEMFDPRKRKFSEEELKPQPMIKKARKVFIPDDLKDDKYWARRRKNNMAAKRSRDARRLKENQIAIRASFLEKENSALRQEVADLRKELGKCKNILAKYEARHGPL |
Proteomic databases
PTM databases
Expression
Induction
Accumulates according to a robust circadian rhythm. Displays only a moderate amplitude in the liver (1.6-fold) and none in the brain.
Gene expression databases
Structure
Family & Domains
Features
Showing features for compositional bias, region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 36-53 | Basic and acidic residues | ||||
Sequence: PEDAFSKEKDKGKKLDDE | ||||||
Region | 36-76 | Disordered | ||||
Sequence: PEDAFSKEKDKGKKLDDESSSPTVPQSAFLGPTLWDKTLPY | ||||||
Region | 92-149 | Disordered | ||||
Sequence: LSENGIPPSPSQHDHSPHPPGLQPASSTAPSVMDLSSRATAPLHPGIPSPNCMQSPIR | ||||||
Compositional bias | 112-126 | Polar residues | ||||
Sequence: GLQPASSTAPSVMDL | ||||||
Domain | 225-288 | bZIP | ||||
Sequence: DDKYWARRRKNNMAAKRSRDARRLKENQIAIRASFLEKENSALRQEVADLRKELGKCKNILAKY | ||||||
Region | 227-247 | Basic motif | ||||
Sequence: KYWARRRKNNMAAKRSRDARR | ||||||
Region | 248-255 | Leucine-zipper | ||||
Sequence: LKENQIAI |
Sequence similarities
Belongs to the bZIP family. PAR subfamily.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length295
- Mass (Da)33,149
- Last updated2003-03-01 v1
- ChecksumD57CAB8601A954B4
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
H3BKN8 | H3BKN8_MOUSE | Hlf | 142 |
Sequence caution
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 27-38 | in Ref. 2; AAH57693 | ||||
Sequence: ENPLKLPLHPED → KKQSSPFPFSSS | ||||||
Compositional bias | 36-53 | Basic and acidic residues | ||||
Sequence: PEDAFSKEKDKGKKLDDE | ||||||
Compositional bias | 112-126 | Polar residues | ||||
Sequence: GLQPASSTAPSVMDL | ||||||
Sequence conflict | 224 | in Ref. 2; AAH57693 | ||||
Sequence: K → KQ |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK054062 EMBL· GenBank· DDBJ | BAC35642.1 EMBL· GenBank· DDBJ | mRNA | ||
BC057693 EMBL· GenBank· DDBJ | AAH57693.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
BC058705 EMBL· GenBank· DDBJ | AAH58705.1 EMBL· GenBank· DDBJ | mRNA |