Q8BTG7 · NDRG4_MOUSE
- ProteinProtein NDRG4
- GeneNdrg4
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids352 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Contributes to the maintenance of intracerebral BDNF levels within the normal range, which is necessary for the preservation of spatial learning and the resistance to neuronal cell death caused by ischemic stress. May enhance growth factor-induced ERK1 and ERK2 phosphorylation. May attenuate NGF-promoted ELK1 phosphorylation in a microtubule-dependent manner.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | basolateral plasma membrane | |
Cellular Component | cell projection membrane | |
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Cellular Component | endoplasmic reticulum membrane | |
Biological Process | cell migration involved in heart development | |
Biological Process | negative regulation of platelet-derived growth factor receptor signaling pathway | |
Biological Process | negative regulation of smooth muscle cell migration | |
Biological Process | negative regulation of smooth muscle cell proliferation | |
Biological Process | positive regulation of ERK1 and ERK2 cascade | |
Biological Process | positive regulation of neuron projection development | |
Biological Process | regulation of endocytic recycling | |
Biological Process | signal transduction | |
Biological Process | vesicle docking | |
Biological Process | visual learning |
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameProtein NDRG4
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ8BTG7
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Mutant mice have impaired spatial learning and memory but normal motor function.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 16 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000159580 | 1-352 | Protein NDRG4 | |||
Sequence: MPECWDGEHDIETPYGLLHVVIRGSPKGNRPAILTYHDVGLNHKLCFNTFFNFEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQFPSMEQLAAMLPSVVQHFGFKYVIGIGVGAGAYVLAKFALIFPDLVEGLVLMNIDPNGKGWIDWAATKLSGLTSTLPDTVLSHLFSQEELVNNTELVQSYRQQISNVVNQANLQLFWNMYNSRRDLDINRPGTVPNAKTLRCPVMLVVGDNAPAEEGVVECNSKLDPTTTTFLKMADSGGLPQVTQPGKLTEAFKYFLQGMGYIAHLKDRRLSGGAVPSASMTRLARSRTASLTSASSVDGSRPQPCAHSDSSEGMGQVNHTMEVSC | ||||||
Modified residue | 293 | In isoform Q8BTG7-2; Phosphoserine | ||||
Sequence: K | ||||||
Modified residue | 298 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 317 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 323 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Predominantly expressed in the brain (at protein level). Detected in neurons of various parts of brain, including the olfactory bulb, olfactory tuberculum, cerebral cortex, striatum, hippocampus, dentate gyrus, thalamus, hypothalamus, mesencephalon, cerebellum, pons and medulla oblongata.
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 301-352 | Disordered | ||||
Sequence: AVPSASMTRLARSRTASLTSASSVDGSRPQPCAHSDSSEGMGQVNHTMEVSC | ||||||
Compositional bias | 308-352 | Polar residues | ||||
Sequence: TRLARSRTASLTSASSVDGSRPQPCAHSDSSEGMGQVNHTMEVSC |
Sequence similarities
Belongs to the NDRG family.
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing.
Q8BTG7-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length352
- Mass (Da)38,509
- Last updated2003-03-01 v1
- Checksum3ED388148DC852CD
Q8BTG7-2
- Name2
- Differences from canonical
- 289-302: IAHLKDRRLSGGAV → M
Q8BTG7-3
- Name3
- Differences from canonical
- 1-7: MPECWDG → MKVLGHRLQLLTGLLLHDVTMAGLQELRFPEEKPLLRGQDATEMDNPDAFLSIVDTDWK
Computationally mapped potential isoform sequences
There are 5 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
E9Q168 | E9Q168_MOUSE | Ndrg4 | 81 | ||
A0A1D5RM17 | A0A1D5RM17_MOUSE | Ndrg4 | 109 | ||
A0A1D5RM37 | A0A1D5RM37_MOUSE | Ndrg4 | 51 | ||
A0A1D5RMH3 | A0A1D5RMH3_MOUSE | Ndrg4 | 197 | ||
E0CZ50 | E0CZ50_MOUSE | Ndrg4 | 224 |
Sequence caution
Features
Showing features for alternative sequence, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_022958 | 1-7 | in isoform 3 | |||
Sequence: MPECWDG → MKVLGHRLQLLTGLLLHDVTMAGLQELRFPEEKPLLRGQDATEMDNPDAFLSIVDTDWK | ||||||
Alternative sequence | VSP_022959 | 289-302 | in isoform 2 | |||
Sequence: IAHLKDRRLSGGAV → M | ||||||
Compositional bias | 308-352 | Polar residues | ||||
Sequence: TRLARSRTASLTSASSVDGSRPQPCAHSDSSEGMGQVNHTMEVSC |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK090374 EMBL· GenBank· DDBJ | BAC41189.1 EMBL· GenBank· DDBJ | mRNA | ||
AK168873 EMBL· GenBank· DDBJ | BAE40691.1 EMBL· GenBank· DDBJ | mRNA | ||
AK129305 EMBL· GenBank· DDBJ | BAC98115.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
BC006595 EMBL· GenBank· DDBJ | AAH06595.1 EMBL· GenBank· DDBJ | mRNA |