Q8BRM6 · MEI4_MOUSE
- ProteinMeiosis-specific protein MEI4
- GeneMei4
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids389 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Required for DNA double-strand breaks (DSBs) formation in unsynapsed regions during meiotic recombination (PubMed:20551173, PubMed:25795304, PubMed:27723721).
Probably acts by forming a complex with IHO1 and REC114, which activates DSBs formation in unsynapsed regions, an essential step to ensure completion of synapsis (PubMed:27723721).
Probably acts by forming a complex with IHO1 and REC114, which activates DSBs formation in unsynapsed regions, an essential step to ensure completion of synapsis (PubMed:27723721).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chromosome | |
Cellular Component | lateral element | |
Biological Process | DNA recombination | |
Biological Process | homologous chromosome pairing at meiosis | |
Biological Process | meiotic DNA double-strand break formation | |
Biological Process | oogenesis | |
Biological Process | spermatogenesis |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameMeiosis-specific protein MEI4
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ8BRM6
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Specifically localizes to unsynapsed chromosomal regions during meiosis (PubMed:25795304, PubMed:27723721).
Located in discrete foci on the axes of meiotic chromosomes. The number of foci is highest at leptonema, decreases at zygonema and is strongly reduced in pachynema and subsequent stages (PubMed:20551173).
Located in discrete foci on the axes of meiotic chromosomes. The number of foci is highest at leptonema, decreases at zygonema and is strongly reduced in pachynema and subsequent stages (PubMed:20551173).
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Deficient DNA double-strand break formation during meiotic recombination.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 39 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000343704 | 1-389 | Meiosis-specific protein MEI4 | |||
Sequence: MDIQPWYLKTSKLALALAIIHSKPADRSSREYTEYLASLVTQKESTWKSKLEALEAEVLQLRQKLLLSRISSGLFKNGPDVLPTLSDQEPTSSENTLTLMDDSGCVLSNEQRNEPAELSQHFVESTDPPLLPLPLEKRPRTTLENPLSSHMQFFQHLLELKKWTESSSLKVYLTHFEKDSSTVSDSVSQLLDALITFYRNPKLPFSSFWTEAVGTLARLASDFNLSNHIFKRCSKKLEEFEKTLLQAILENNSINRFQVQRYVSQSLVTLGSCSLLRKSIISLLLSEVNSFVDDLGAIDQDQGIYDVTRYENIFSLFWILEQVLQQAPQGDRTAHMDHSIPEMQTFLQKHDEVIFRLSDAFPLFAFYLWRLGVLLNSAEMETVKNESLP |
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in adult testis and brain and in embryonic ovary.
Developmental stage
In the testis, expression is detected at 4 days postpartum (dpp) with a peak between days 10 and 14. Levels decrease by 18 dpp with a further decrease in the adult.
Gene expression databases
Interaction
Subunit
Part of the MCD recombinosome complex, at least composed of IHO1, REC114 and MEI4 (PubMed:27723721, PubMed:30569039).
Forms a complex with REC114; the interaction is required for MEI4 stability (PubMed:20551173, PubMed:30569039).
Interacts (via N-terminal domain) with REC114 (via C-terminal domain) (PubMed:20551173, PubMed:30569039).
Interacts with IHO1 (PubMed:30569039).
Forms a complex with REC114; the interaction is required for MEI4 stability (PubMed:20551173, PubMed:30569039).
Interacts (via N-terminal domain) with REC114 (via C-terminal domain) (PubMed:20551173, PubMed:30569039).
Interacts with IHO1 (PubMed:30569039).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q8BRM6 | Rec114 Q9CWH4 | 5 | EBI-9548252, EBI-9548270 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-127 | Interaction with REC114 | ||||
Sequence: MDIQPWYLKTSKLALALAIIHSKPADRSSREYTEYLASLVTQKESTWKSKLEALEAEVLQLRQKLLLSRISSGLFKNGPDVLPTLSDQEPTSSENTLTLMDDSGCVLSNEQRNEPAELSQHFVESTD |
Sequence similarities
Belongs to the MEI4L family.
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q8BRM6-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length389
- Mass (Da)44,471
- Last updated2003-03-01 v1
- Checksum04B41F13A4A3FCD1
Q8BRM6-2
- Name2
- Differences from canonical
- 301-389: DQGIYDVTRYENIFSLFWILEQVLQQAPQGDRTAHMDHSIPEMQTFLQKHDEVIFRLSDAFPLFAFYLWRLGVLLNSAEMETVKNESLP → ALPVELADSIQA
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A087WP18 | A0A087WP18_MOUSE | Mei4 | 290 |
Sequence caution
Features
Showing features for sequence conflict, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 44 | in Ref. 3; AAH96613 | ||||
Sequence: E → D | ||||||
Alternative sequence | VSP_034675 | 301-389 | in isoform 2 | |||
Sequence: DQGIYDVTRYENIFSLFWILEQVLQQAPQGDRTAHMDHSIPEMQTFLQKHDEVIFRLSDAFPLFAFYLWRLGVLLNSAEMETVKNESLP → ALPVELADSIQA |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK043929 EMBL· GenBank· DDBJ | BAC31705.1 EMBL· GenBank· DDBJ | mRNA | ||
AK082395 EMBL· GenBank· DDBJ | BAC38486.1 EMBL· GenBank· DDBJ | mRNA | Frameshift | |
AC122931 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC132430 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC096613 EMBL· GenBank· DDBJ | AAH96613.1 EMBL· GenBank· DDBJ | mRNA |