Q8BMN3 · ACHB3_MOUSE
- ProteinNeuronal acetylcholine receptor subunit beta-3
- GeneChrnb3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids464 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | acetylcholine-gated channel complex | |
Cellular Component | dopaminergic synapse | |
Cellular Component | neuron projection | |
Cellular Component | plasma membrane | |
Cellular Component | postsynaptic membrane | |
Cellular Component | presynapse | |
Cellular Component | protein-containing complex | |
Cellular Component | synapse | |
Molecular Function | acetylcholine binding | |
Molecular Function | acetylcholine-gated monoatomic cation-selective channel activity | |
Molecular Function | heterocyclic compound binding | |
Molecular Function | transmembrane signaling receptor activity | |
Biological Process | acetylcholine receptor signaling pathway | |
Biological Process | membrane depolarization | |
Biological Process | presynaptic modulation of chemical synaptic transmission | |
Biological Process | response to nicotine | |
Biological Process | synaptic transmission, cholinergic |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameNeuronal acetylcholine receptor subunit beta-3
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ8BMN3
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Postsynaptic cell membrane ; Multi-pass membrane protein
Cell membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 31-238 | Extracellular | ||||
Sequence: VAEHEDALLRHLFQGYQKCVRPVLNSSDIIKVYFGLKISQLVDVDEKNQLMTTNVWLKQEWTDQKLRWNPEDYGGINSIKVPSESLWLPDIVLFENADGRFEGSLMTKAIVKSSGTVSWTPPASYKSSCTMDVTFFPFDKQNCSMKFGSWTYDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRREGFYSYPFVTYSFVLRRL | ||||||
Transmembrane | 239-263 | Helical | ||||
Sequence: PLFYTLFLIIPCLGLSFLTVLVFYL | ||||||
Transmembrane | 271-288 | Helical | ||||
Sequence: LSLSTSVLVSLTVFLLVI | ||||||
Transmembrane | 305-326 | Helical | ||||
Sequence: YLLFIMIFVTLSIIVTVFVINV | ||||||
Topological domain | 327-434 | Cytoplasmic | ||||
Sequence: HHRSSSTYHPMAPWVKRLFLEKLPRWLCMKDPRDRFSFPDGTESKGTVRGKFPGKKKQTPTSDGERVLVAFLEKASESIRYISRHVKKEHFISQVVQDWKFVAQVLDR | ||||||
Transmembrane | 435-453 | Helical | ||||
Sequence: IFLWLFLTASVLGSVLIFI |
Keywords
- Cellular component
Phenotypes & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 28 variants from UniProt as well as other sources including ClinVar and dbSNP.
Chemistry
PTM/Processing
Features
Showing features for signal, chain, glycosylation, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-30 | |||||
Sequence: MTGFLRVFLALSATLSGSWVTLTATAGLSS | ||||||
Chain | PRO_0000000384 | 31-464 | Neuronal acetylcholine receptor subunit beta-3 | |||
Sequence: VAEHEDALLRHLFQGYQKCVRPVLNSSDIIKVYFGLKISQLVDVDEKNQLMTTNVWLKQEWTDQKLRWNPEDYGGINSIKVPSESLWLPDIVLFENADGRFEGSLMTKAIVKSSGTVSWTPPASYKSSCTMDVTFFPFDKQNCSMKFGSWTYDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRREGFYSYPFVTYSFVLRRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSSSTYHPMAPWVKRLFLEKLPRWLCMKDPRDRFSFPDGTESKGTVRGKFPGKKKQTPTSDGERVLVAFLEKASESIRYISRHVKKEHFISQVVQDWKFVAQVLDRIFLWLFLTASVLGSVLIFIPALKMWIHRFH | ||||||
Glycosylation | 55 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 159↔173 | |||||
Sequence: CTMDVTFFPFDKQNC | ||||||
Glycosylation | 172 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Subunit
Neuronal AChR seems to be composed of two different types of subunits: alpha and beta.
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 368-387 | Disordered | ||||
Sequence: TESKGTVRGKFPGKKKQTPT |
Sequence similarities
Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Beta-3/CHRNB3 sub-subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 2 isoforms produced by Alternative splicing.
Q8BMN3-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length464
- Mass (Da)53,112
- Last updated2003-03-01 v1
- Checksum2ECEA3E0DAF2D5EB
Q8BMN3-2
- Name2
- Differences from canonical
- 75-89: Missing
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q3UZS0 | Q3UZS0_MOUSE | Chrnb3 | 454 |
Features
Showing features for alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_013775 | 75-89 | in isoform 2 | |||
Sequence: Missing | ||||||
Sequence conflict | 170 | in Ref. 1; AAL75573 | ||||
Sequence: K → R |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF467896 EMBL· GenBank· DDBJ | AAL75573.1 EMBL· GenBank· DDBJ | mRNA | ||
AY574268 EMBL· GenBank· DDBJ | AAS90364.1 EMBL· GenBank· DDBJ | mRNA | ||
AK017571 EMBL· GenBank· DDBJ | BAB30812.1 EMBL· GenBank· DDBJ | mRNA | ||
AK030464 EMBL· GenBank· DDBJ | BAC26973.1 EMBL· GenBank· DDBJ | mRNA | ||
BC058193 EMBL· GenBank· DDBJ | AAH58193.1 EMBL· GenBank· DDBJ | mRNA |