Q8BK72 · RT27_MOUSE
- ProteinSmall ribosomal subunit protein mS27
- GeneMrps27
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids415 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
RNA-binding component of the mitochondrial small ribosomal subunit (mt-SSU) that plays a role in mitochondrial protein synthesis. Stimulates mitochondrial mRNA translation of subunit components of the mitochondrial electron transport chain. Binds to the mitochondrial 12S rRNA (12S mt-rRNA) and tRNA(Glu). Overexpressed in hepatocellular carcinoma tissues compared with adjacent non-tumoral liver tissues.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial inner membrane | |
Cellular Component | mitochondrial small ribosomal subunit | |
Cellular Component | mitochondrion | |
Cellular Component | nucleolus | |
Molecular Function | mitochondrial ribosome binding | |
Molecular Function | rRNA binding | |
Molecular Function | tRNA binding | |
Biological Process | cell population proliferation | |
Biological Process | mitochondrial translation | |
Biological Process | positive regulation of mitochondrial translation |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSmall ribosomal subunit protein mS27
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ8BK72
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for transit peptide, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transit peptide | 1-17 | Mitochondrion | ||||
Sequence: MAAPMVRCGMLLARRLD | ||||||
Chain | PRO_0000261586 | 18-415 | Small ribosomal subunit protein mS27 | |||
Sequence: ASRLCLAGKRCLLSAAYVDSHQWEAREKEEYHLADLASLMDKAYERKLPVSSLSISRFVDNIASREDLDSAEYYLYKFRHSPNCWYLRDWTIHSWIRQCLKYGAQDKALYTLVNKVQYGIFPDNFTFNLLMDYFIKKGNYKDALSVVFEIMMQEAFDVPSTQFLSLYVLYRCLAEKTELTWEEERDFGASLLLSGLKQRNTVGLSSQLYGYALLGKVELQRGVRAVYHGMPLMWTPGYLDRALQVMERVASSPEDLKLGREVLDVLDGVLKVVTSPDVQTSEAQPQEGEDGLGSANLVEQLDTEEPEQSKLPRYLERFQASRSKLQELNRVESESLLTLTTQLVKEKLPACEAEDLATYEQKLREWHLERVQLIQREQEQREKAKQEYQALSAAEKAA |
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Subunit
Component of the mitochondrial ribosome small subunit (28S) which comprises a 12S rRNA and about 30 distinct proteins (By similarity).
Interacts with NOA1 (By similarity).
Interacts with MIEF1 upstream open reading frame protein (By similarity).
Interacts with METTL17 (PubMed:31487196).
Interacts with NOA1 (By similarity).
Interacts with MIEF1 upstream open reading frame protein (By similarity).
Interacts with METTL17 (PubMed:31487196).
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for repeat, coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 105-139 | PPR 1 | ||||
Sequence: RDWTIHSWIRQCLKYGAQDKALYTLVNKVQYGIFP | ||||||
Repeat | 140-175 | PPR 2 | ||||
Sequence: DNFTFNLLMDYFIKKGNYKDALSVVFEIMMQEAFDV | ||||||
Coiled coil | 369-415 | |||||
Sequence: EAEDLATYEQKLREWHLERVQLIQREQEQREKAKQEYQALSAAEKAA |
Sequence similarities
Belongs to the mitochondrion-specific ribosomal protein mS27 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length415
- Mass (Da)47,779
- Last updated2011-07-27 v2
- Checksum188A19628C12CA26
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A338P7I7 | A0A338P7I7_MOUSE | Mrps27 | 289 |
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 81 | in Ref. 1; BAC36116 | ||||
Sequence: S → C |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK076008 EMBL· GenBank· DDBJ | BAC36116.1 EMBL· GenBank· DDBJ | mRNA | ||
AC132347 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |