Q8BHA3 · DTD2_MOUSE
- ProteinD-aminoacyl-tRNA deacylase 2
- GeneDtd2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids168 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Deacylates mischarged D-aminoacyl-tRNAs. Also deacylates mischarged glycyl-tRNA(Ala), protecting cells against glycine mischarging by AlaRS. Probably acts by rejecting L-amino acids from its binding site rather than specific recognition of D-amino acids. Catalyzes the hydrolysis of D-tyrosyl-tRNA(Tyr), has no activity on correctly charged L-tyrosyl-tRNA(Tyr). By recycling D-aminoacyl-tRNA to D-amino acids and free tRNA molecules, this enzyme counteracts the toxicity associated with the formation of D-aminoacyl-tRNA entities in vivo and helps enforce protein L-homochirality. In contrast to DTD1, deacylates L-Ala mischarged on tRNA(Thr)(G4.U69) by alanine-tRNA ligase AARS. Can deacylate L-Ala due to a relaxed specificity for substrate chirality caused by the trans conformation of the Gly-Pro motif in the active site. Also hydrolyzes correctly charged, achiral, glycyl-tRNA(Gly) in vitro, although in vivo EEF1A1/EF-Tu may protect cognate achiral glycyl-tRNA(Gly) from DTD2-mediated deacetylation.
Catalytic activity
- a D-aminoacyl-tRNA + H2O = a D-alpha-amino acid + a tRNA + H+
- D-tyrosyl-tRNA(Tyr) + H2O = D-tyrosine + tRNA(Tyr)
- H2O + L-alanyl-tRNA(Thr) = H+ + L-alanine + tRNA(Thr)
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Molecular Function | Ala-tRNA(Thr) hydrolase activity | |
Molecular Function | D-tyrosyl-tRNA(Tyr) deacylase activity | |
Molecular Function | tRNA binding | |
Biological Process | aminoacyl-tRNA metabolism involved in translational fidelity | |
Biological Process | tRNA metabolic process |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameD-aminoacyl-tRNA deacylase 2
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ8BHA3
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000254050 | 1-168 | D-aminoacyl-tRNA deacylase 2 | |||
Sequence: MADGGRVAQARALLQQCLHARLQVRPADGDAAAQWVEIRRGLVIYVCFFKGADTDLLPKMVNTLLNVKLSETETGKHVSILDLPGDVLIIPQATLGGRVKGRSMQYHSNSGKEEGSELYSQFVSLCEKAVANNTKSVEAGVAVAHGTYGNRQVLKLDTNGPYTHLIEF |
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Motif | 160-161 | Gly-transPro motif, allows the protein to recognize chirality of D-amino acids | ||||
Sequence: GP |
Domain
A Gly-transPro motif from one monomer fits into the active site of the other monomer to allow specific chiral rejection of most L-amino acids except L-Ala. The trans conformation of the motif is maintained by Arg-151.
Sequence similarities
Belongs to the DTD family.
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q8BHA3-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length168
- Mass (Da)18,236
- Last updated2003-03-01 v1
- Checksum3CE2A5393043A5A4
Q8BHA3-2
- Name2
- Differences from canonical
- 152-168: QVLKLDTNGPYTHLIEF → WSHTQKELQTLLTAF
Sequence caution
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_021174 | 152-168 | in isoform 2 | |||
Sequence: QVLKLDTNGPYTHLIEF → WSHTQKELQTLLTAF |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK016300 EMBL· GenBank· DDBJ | BAB30185.1 EMBL· GenBank· DDBJ | mRNA | ||
AK018311 EMBL· GenBank· DDBJ | BAB31157.1 EMBL· GenBank· DDBJ | mRNA | Frameshift | |
AK032228 EMBL· GenBank· DDBJ | BAC27771.1 EMBL· GenBank· DDBJ | mRNA | ||
AK042771 EMBL· GenBank· DDBJ | BAC31360.1 EMBL· GenBank· DDBJ | mRNA | ||
BC089589 EMBL· GenBank· DDBJ | AAH89589.1 EMBL· GenBank· DDBJ | mRNA |