Q8BGF9 · S2544_MOUSE
- ProteinSolute carrier family 25 member 44
- GeneSlc25a44
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids314 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Mitochondrial solute transporter which transports branched-chain amino acid (BCAA; valine, leucine and isoleucine) into mitochondria in brown adipose tissue (BAT) (PubMed:31435015).
BAT is involved in BCAA catabolism and actively utilizes BCAA in the mitochondria for thermogenesis (PubMed:31435015).
BAT is involved in BCAA catabolism and actively utilizes BCAA in the mitochondria for thermogenesis (PubMed:31435015).
Catalytic activity
- L-valine(in) = L-valine(out)
- L-leucine(in) = L-leucine(out)
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial inner membrane | |
Cellular Component | mitochondrion | |
Molecular Function | branched-chain amino acid transmembrane transporter activity | |
Biological Process | amino acid transport | |
Biological Process | branched-chain amino acid catabolic process | |
Biological Process | branched-chain amino acid transport | |
Biological Process | regulation of cold-induced thermogenesis |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameSolute carrier family 25 member 44
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ8BGF9
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Mitochondrion membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 20-42 | Helical; Name=1 | ||||
Sequence: FYVFGVAMTMMIRVSVYPFTLIR | ||||||
Transmembrane | 71-90 | Helical; Name=2 | ||||
Sequence: AGLYRGFLVNTFTLISGQCY | ||||||
Transmembrane | 113-133 | Helical; Name=3 | ||||
Sequence: LVAGGSASLVAQSITVPIDVV | ||||||
Transmembrane | 185-201 | Helical; Name=4 | ||||
Sequence: GYVASLLTYIPNSAVWW | ||||||
Transmembrane | 222-239 | Helical; Name=5 | ||||
Sequence: IVFQAISGPLAAATASIL | ||||||
Transmembrane | 278-296 | Helical; Name=6 | ||||
Sequence: LSARIISATPSTIVIVVGY |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000253065 | 1-314 | Solute carrier family 25 member 44 | |||
Sequence: MEDKRNIQIIEWEHLDKKKFYVFGVAMTMMIRVSVYPFTLIRTRLQVQKGKSLYHGTFDAFVKILRADGVAGLYRGFLVNTFTLISGQCYVTTYELTRKFVADYSQSNTVKSLVAGGSASLVAQSITVPIDVVSQHLMMQRKGEKMGRFQVHGNLEGQGVIAFGQTKDIIRQILRADGLRGFYRGYVASLLTYIPNSAVWWPFYHFYAEQLSRLCPQECPHIVFQAISGPLAAATASILTNPMDVIRTRVQVEGKSSIVLTFRQLMAEEGPWGLMKGLSARIISATPSTIVIVVGYESLKKLSLRPELVDSRHW |
Proteomic databases
PTM databases
Expression
Tissue specificity
Highly expressed in brown adipose tissues compared with other metabolic organs.
Induction
Induction by cold exposure in brown adipose tissues.
Developmental stage
Expression increases during adipogenesis.
Gene expression databases
Structure
Family & Domains
Features
Showing features for repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 18-100 | Solcar 1 | ||||
Sequence: KKFYVFGVAMTMMIRVSVYPFTLIRTRLQVQKGKSLYHGTFDAFVKILRADGVAGLYRGFLVNTFTLISGQCYVTTYELTRKF | ||||||
Repeat | 107-210 | Solcar 2 | ||||
Sequence: SNTVKSLVAGGSASLVAQSITVPIDVVSQHLMMQRKGEKMGRFQVHGNLEGQGVIAFGQTKDIIRQILRADGLRGFYRGYVASLLTYIPNSAVWWPFYHFYAEQ | ||||||
Repeat | 220-302 | Solcar 3 | ||||
Sequence: PHIVFQAISGPLAAATASILTNPMDVIRTRVQVEGKSSIVLTFRQLMAEEGPWGLMKGLSARIISATPSTIVIVVGYESLKKL |
Sequence similarities
Belongs to the mitochondrial carrier (TC 2.A.29) family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length314
- Mass (Da)35,339
- Last updated2003-03-01 v1
- Checksum9CA4C54D7C23A2AE
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK032960 EMBL· GenBank· DDBJ | BAC28100.1 EMBL· GenBank· DDBJ | mRNA | ||
AK046586 EMBL· GenBank· DDBJ | BAC32798.1 EMBL· GenBank· DDBJ | mRNA | ||
AK083273 EMBL· GenBank· DDBJ | BAC38838.1 EMBL· GenBank· DDBJ | mRNA | ||
AK083470 EMBL· GenBank· DDBJ | BAC38927.1 EMBL· GenBank· DDBJ | mRNA | ||
BC052771 EMBL· GenBank· DDBJ | AAH52771.2 EMBL· GenBank· DDBJ | mRNA |