Q89U93 · Q89U93_BRADU
- ProteinTransketolase
- GenetktA
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids671 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Catalyzes the transfer of a two-carbon ketol group from a ketose donor to an aldose acceptor, via a covalent intermediate with the cofactor thiamine pyrophosphate.
Catalytic activity
- D-sedoheptulose 7-phosphate + D-glyceraldehyde 3-phosphate = aldehydo-D-ribose 5-phosphate + D-xylulose 5-phosphate
Cofactor
Protein has several cofactor binding sites:
Ca2+ (UniProtKB | Rhea| CHEBI:29108 )
Mn2+ (UniProtKB | Rhea| CHEBI:29035 )
Co2+ (UniProtKB | Rhea| CHEBI:48828 )
Note: Binds 1 Mg2+ ion per subunit. Can also utilize other divalent metal cations, such as Ca2+, Mn2+ and Co2+.
Note: Binds 1 thiamine pyrophosphate per subunit.
Features
Showing features for binding site, site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 38 | substrate | ||||
Sequence: H | ||||||
Site | 38 | Important for catalytic activity | ||||
Sequence: H | ||||||
Binding site | 269 | substrate | ||||
Sequence: H | ||||||
Site | 269 | Important for catalytic activity | ||||
Sequence: H | ||||||
Binding site | 364 | substrate | ||||
Sequence: R | ||||||
Binding site | 392 | substrate | ||||
Sequence: S | ||||||
Binding site | 469 | substrate | ||||
Sequence: H | ||||||
Binding site | 477 | substrate | ||||
Sequence: D | ||||||
Binding site | 481 | substrate | ||||
Sequence: H | ||||||
Binding site | 528 | substrate | ||||
Sequence: R |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Molecular Function | metal ion binding | |
Molecular Function | transketolase activity | |
Biological Process | pentose-phosphate shunt |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameTransketolase
- EC number
Gene names
Organism names
- Strain
- Taxonomic lineageBacteria > Pseudomonadota > Alphaproteobacteria > Hyphomicrobiales > Nitrobacteraceae > Bradyrhizobium
Accessions
- Primary accessionQ89U93
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Interaction
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 361-533 | Transketolase-like pyrimidine-binding | ||||
Sequence: AATRKSSEAVIEVIAGAMPMEFLAGSADLTGSNNNKAKSATAFSAKTPKGRFIHYGIREHGMAAAMNGIFLHGGFAPNGATFLVFTDYARPAMRLAALMGTGVVYVMTHDSIGLGEDGPTHQPVEHLAALRAIPNMRVFRPCDSIEVAECWELALNRIDGPTVLALTRQNLPQ |
Sequence similarities
Belongs to the transketolase family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length671
- Mass (Da)71,529
- Last updated2003-06-01 v1
- ChecksumE290A66BE559EAFB
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BA000040 EMBL· GenBank· DDBJ | BAC46789.1 EMBL· GenBank· DDBJ | Genomic DNA |