Q89AA6 · CYOD_BUCBP
- ProteinCytochrome bo(3) ubiquinol oxidase subunit 4
- GenecyoD
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids100 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Cytochrome bo3 ubiquinol terminal oxidase is the component of the aerobic respiratory chain of E.coli that predominates when cells are grown at high aeration. Has proton pump activity across the membrane in addition to electron transfer, pumping 2 protons/electron (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytochrome o ubiquinol oxidase complex | |
Cellular Component | plasma membrane | |
Molecular Function | cytochrome bo3 ubiquinol oxidase activity | |
Molecular Function | proton transmembrane transporter activity | |
Biological Process | aerobic electron transport chain | |
Biological Process | electron transport coupled proton transport |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameCytochrome bo(3) ubiquinol oxidase subunit 4
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageBacteria > Pseudomonadota > Gammaproteobacteria > Enterobacterales > Erwiniaceae > Buchnera
Accessions
- Primary accessionQ89AA6
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-9 | Cytoplasmic | ||||
Sequence: MLKNRYLKY | ||||||
Transmembrane | 10-32 | Helical | ||||
Sequence: LFILILLSILSIMPIFAIIYRIF | ||||||
Topological domain | 33-36 | Extracellular | ||||
Sequence: SRNY | ||||||
Transmembrane | 37-59 | Helical | ||||
Sequence: LYAFIIVCLFFQILAHIKFFLNL | ||||||
Topological domain | 60-68 | Cytoplasmic | ||||
Sequence: DFSLEQRWK | ||||||
Transmembrane | 69-90 | Helical | ||||
Sequence: LISVIFSLVVGLIILLGSIWVI | ||||||
Topological domain | 91-100 | Extracellular | ||||
Sequence: KNLNNNLCIM |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000183915 | 1-100 | Cytochrome bo3 ubiquinol oxidase subunit 4 | |||
Sequence: MLKNRYLKYLFILILLSILSIMPIFAIIYRIFSRNYLYAFIIVCLFFQILAHIKFFLNLDFSLEQRWKLISVIFSLVVGLIILLGSIWVIKNLNNNLCIM |
Interaction
Subunit
Heterooctamer of two A chains, two B chains, two C chains and two D chains.
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Length100
- Mass (Da)11,923
- Last updated2003-06-01 v1
- Checksum7C8F79C5079532E1
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AE016826 EMBL· GenBank· DDBJ | AAO27124.1 EMBL· GenBank· DDBJ | Genomic DNA |