Q89703 · POL_CSVMV
- ProteinPutative enzymatic polyprotein
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids652 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Encodes for at least two polypeptides: protease (PR) and reverse transcriptase (RT). The protease processes the polyprotein in cis. Reverse transcriptase is multifunctional enzyme that converts the viral RNA genome into dsDNA in viral cytoplasmic capsids. This enzyme displays a DNA polymerase activity that can copy either DNA or RNA templates, and a ribonuclease H (RNase H) activity that cleaves the RNA strand of RNA-DNA heteroduplexes in a partially processive 3'- to 5'-endonucleasic mode. Neo-synthesized pregenomic RNA (pgRNA) are encapsidated, and reverse-transcribed inside the nucleocapsid. Partial +DNA is synthesized from the -DNA template and generates the relaxed circular DNA (RC-DNA) genome. After budding and infection, the RC-DNA migrates in the nucleus, and is converted into a plasmid-like covalently closed circular DNA (cccDNA) (By similarity).
Catalytic activity
- a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1)
Features
Showing features for active site, binding site.
GO annotations
Aspect | Term | |
---|---|---|
Molecular Function | aspartic-type endopeptidase activity | |
Molecular Function | DNA binding | |
Molecular Function | DNA-directed DNA polymerase activity | |
Molecular Function | metal ion binding | |
Molecular Function | RNA binding | |
Molecular Function | RNA-directed DNA polymerase activity | |
Molecular Function | RNA-DNA hybrid ribonuclease activity | |
Biological Process | DNA recombination | |
Biological Process | proteolysis |
Keywords
- Molecular function
- Biological process
- Ligand
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended namePutative enzymatic polyprotein
Including 3 domains:
- Recommended nameProtease
- EC number
- Short namesPR
- Recommended nameReverse transcriptase
- EC number
- Short namesRT
- Recommended nameRibonuclease H
- EC number
Gene names
Organism names
- Taxonomic lineageViruses > Riboviria > Pararnavirae > Artverviricota > Revtraviricetes > Ortervirales > Caulimoviridae > Cavemovirus > Cavemovirus venamanihotis
- Virus hosts
Accessions
- Primary accessionQ89703
Proteomes
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000397901 | 1-652 | Putative enzymatic polyprotein | |||
Sequence: MNKITYMTIKISIPKYMSRIYHGLFDTGANICICKKKVLPDELWHKTENLVLRGFNDEKHVAEYRADNITIMIAKEKFIIPYIYAMDEMSPDIIIGATFYNKYSPIELDIGKGIIKFTKNNEKYPNYLVKYPKKRKLVPWTKGNPSVTETMENIGINQIESRNPIEEEINQILGTDIYGENPLEKWEKHKTLAKIELKNETDNIYKPPMLYQETDLPEFKMHIEEMIKEGFIEEKTNFEDKKYSSPAFIVNKHSEQKRGKTRMVIDYKDLNKKAKVVKYPIPNKDTLIHRSIQARYYSKFDCKSGFYHIKLEEDSKKYTAFTVPQGYYQWKVLPFGYHNSPSIFQQFMDRIFRPYYDFIIVYIDDILVFSKTIEEHKIHIAKFRDITLANGLIISKKKTELCKEKIDFLGVQIEQGGIELQPHIINKILEKHTKIKNKTELQSILGLLNQIRHFIPHLAQILLPIQKKLKIKDEEIWTWTKEDEEKIKLIQDYSKNLVIKMKYPINKEDMNWIIEVDASNNAYGSCLKYKPKNSKIEYLCRYNSGTFKENEQKYDINRKELIAVYQGLQSYSLFTCEGNKLVRTDNSQVYYWIKNDTNKKSIEFRNIKYLLAKIAVYNFEIQLIDGKTNIIADYLSRYNSSDTDGRYDEANT |
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 21-99 | Peptidase A2 | ||||
Sequence: YHGLFDTGANICICKKKVLPDELWHKTENLVLRGFNDEKHVAEYRADNITIMIAKEKFIIPYIYAMDEMSPDIIIGATF | ||||||
Domain | 231-413 | Reverse transcriptase | ||||
Sequence: FIEEKTNFEDKKYSSPAFIVNKHSEQKRGKTRMVIDYKDLNKKAKVVKYPIPNKDTLIHRSIQARYYSKFDCKSGFYHIKLEEDSKKYTAFTVPQGYYQWKVLPFGYHNSPSIFQQFMDRIFRPYYDFIIVYIDDILVFSKTIEEHKIHIAKFRDITLANGLIISKKKTELCKEKIDFLGVQI |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length652
- Mass (Da)77,054
- Last updated1996-11-01 v1
- Checksum564AAF8FDE925F9C
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U20341 EMBL· GenBank· DDBJ | AAA79873.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U59751 EMBL· GenBank· DDBJ | AAB03327.1 EMBL· GenBank· DDBJ | Genomic DNA |