Q88889 · C2_TPCTV
- ProteinProtein C2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids159 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Acts as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs. Suppresses the host RNA silencing by inhibiting adenosine kinase 2 (ADK2), a kinase involved in a general methylation pathway. Also suppresses the host basal defense by interacting with and inhibiting SNF1 kinase, a key regulator of cell metabolism implicated in innate antiviral defense. Determines pathogenicity (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | host cell cytoplasm | |
Cellular Component | viral capsid | |
Molecular Function | metal ion binding | |
Molecular Function | structural molecule activity | |
Biological Process | symbiont-mediated suppression of host innate immune response | |
Biological Process | virus-mediated perturbation of host defense response |
Keywords
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameProtein C2
- Alternative names
Gene names
Organism names
- Taxonomic lineageViruses > Monodnaviria > Shotokuvirae > Cressdnaviricota > Repensiviricetes > Geplafuvirales > Geminiviridae > Topocuvirus
- Virus hosts
Accessions
- Primary accessionQ88889
Proteomes
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000323706 | 1-159 | Protein C2 | |||
Sequence: MVLCDKGAHELGNREIRKGFCERCLYPEYFDDEEAATTTPTIKKRPPKLTWAPKKKRRKAIHLSCGCSYYGGIDCEDGFTHRGITHVHTVPDWLLLRRHQEPNLLPPPEHNNNGDGEQNNNITNQSQPQPAESVGSPDLLAELGGTFSITSSEWRSIIR |
Interaction
Subunit
Monomer. Suppress local silencing by interacting with and inactivating host adenosine kinase 2 (ADK2) in the cytoplasm. Interacts with and inhibits host SNF1 kinase (By similarity).
Structure
Family & Domains
Features
Showing features for motif, zinc finger, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Motif | 43-60 | Nuclear localization signal | ||||
Sequence: KKRPPKLTWAPKKKRRKA | ||||||
Zinc finger | 65-81 | |||||
Sequence: CGCSYYGGIDCEDGFTH | ||||||
Region | 102-139 | Disordered | ||||
Sequence: PNLLPPPEHNNNGDGEQNNNITNQSQPQPAESVGSPDL | ||||||
Compositional bias | 112-133 | Polar residues | ||||
Sequence: NNGDGEQNNNITNQSQPQPAES |
Domain
The zinc finger is involved in PTGS suppression.
Sequence similarities
Belongs to the geminiviridae transcriptional activator protein family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length159
- Mass (Da)17,950
- Last updated1996-11-01 v1
- ChecksumDC0380A2D53ABAD1
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 112-133 | Polar residues | ||||
Sequence: NNGDGEQNNNITNQSQPQPAES |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X84735 EMBL· GenBank· DDBJ | CAA59224.1 EMBL· GenBank· DDBJ | Genomic DNA |